DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mbf1 and MBF1

DIOPT Version :9

Sequence 1:NP_001261952.1 Gene:mbf1 / 39842 FlyBaseID:FBgn0262732 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_014942.4 Gene:MBF1 / 854474 SGDID:S000007253 Length:151 Species:Saccharomyces cerevisiae


Alignment Length:151 Identity:65/151 - (43%)
Similarity:94/151 - (62%) Gaps:6/151 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDWDSVTVLRKKA------PKSSTLKTESAVNQARRQGVAVDTQQKYGAGTNKQHVTTKNTAKL 59
            |||||:.|::..:|      |:::..:::..:|.|||||:.|...:|||:...:.....:...|:
Yeast     1 MSDWDTNTIIGSRARAGGSGPRANVARSQGQINAARRQGLVVSVDKKYGSTNTRGDNEGQRLTKV 65

  Fly    60 DRETEELRHDKIPLDVGKLIQQGRQSKGLSQKDLATKICEKQQVVTDYEAGRGIPNNLILGKMER 124
            ||||:.::..|:..:||:.|.:.|..|.:|||||||||.||..||.||||.|.|||..:|.|:||
Yeast    66 DRETDIVKPKKLDPNVGRAISRARTDKKMSQKDLATKINEKPTVVNDYEAARAIPNQQVLSKLER 130

  Fly   125 VLGIKLRGKERGQPIAPPGKK 145
            .||:||||...|.|:..|.||
Yeast   131 ALGVKLRGNNIGSPLGAPKKK 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mbf1NP_001261952.1 MBF1 2..70 CDD:285695 22/73 (30%)
aMBF1 12..144 CDD:224726 57/137 (42%)
HTH_3 79..131 CDD:279690 31/51 (61%)
MBF1NP_014942.4 MBF1 3..75 CDD:400707 21/71 (30%)
aMBF1 <46..150 CDD:224726 48/103 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346776
Domainoid 1 1.000 64 1.000 Domainoid score I2449
eggNOG 1 0.900 - - E1_COG1813
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2809
Inparanoid 1 1.050 130 1.000 Inparanoid score I1246
Isobase 1 0.950 - 0 Normalized mean entropy S462
OMA 1 1.010 - - QHG54797
OrthoFinder 1 1.000 - - FOG0003409
OrthoInspector 1 1.000 - - oto100272
orthoMCL 1 0.900 - - OOG6_102239
Panther 1 1.100 - - LDO PTHR10245
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R686
SonicParanoid 1 1.000 - - X2304
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.