DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mbf1 and MBF1B

DIOPT Version :9

Sequence 1:NP_001261952.1 Gene:mbf1 / 39842 FlyBaseID:FBgn0262732 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_191427.1 Gene:MBF1B / 825037 AraportID:AT3G58680 Length:142 Species:Arabidopsis thaliana


Alignment Length:134 Identity:65/134 - (48%)
Similarity:89/134 - (66%) Gaps:3/134 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DWDSVTVLRKKAPKSSTLKTESAVNQARRQGVAVDTQQKYGAGTNK--QHVTTKNTAKLDRETEE 65
            ||:.| |:||:||.::..:.|..||.|||.|..::|.:|:.||:||  ...|:.||.|||.:||.
plant    10 DWEPV-VIRKRAPNAAAKRDEKTVNAARRSGADIETVRKFNAGSNKAASSGTSLNTKKLDDDTEN 73

  Fly    66 LRHDKIPLDVGKLIQQGRQSKGLSQKDLATKICEKQQVVTDYEAGRGIPNNLILGKMERVLGIKL 130
            |.||::|.::.|.|.|.|..|.|:|..||..|.||.||:.:||:|:.|||..||.|:||.||.||
plant    74 LSHDRVPTELKKAIMQARGEKKLTQSQLAHLINEKPQVIQEYESGKAIPNQQILSKLERALGAKL 138

  Fly   131 RGKE 134
            |||:
plant   139 RGKK 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mbf1NP_001261952.1 MBF1 2..70 CDD:285695 31/68 (46%)
aMBF1 12..144 CDD:224726 60/125 (48%)
HTH_3 79..131 CDD:279690 27/51 (53%)
MBF1BNP_191427.1 MBF1 10..77 CDD:400707 30/67 (45%)
aMBF1 <85..141 CDD:331548 30/55 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 64 1.000 Domainoid score I3663
eggNOG 1 0.900 - - E1_COG1813
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2809
Inparanoid 1 1.050 126 1.000 Inparanoid score I1928
OMA 1 1.010 - - QHG54797
OrthoDB 1 1.010 - - D1571466at2759
OrthoFinder 1 1.000 - - FOG0003409
OrthoInspector 1 1.000 - - otm2592
orthoMCL 1 0.900 - - OOG6_102239
Panther 1 1.100 - - O PTHR10245
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2304
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.