DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mbf1 and Edf1

DIOPT Version :9

Sequence 1:NP_001261952.1 Gene:mbf1 / 39842 FlyBaseID:FBgn0262732 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_030107780.1 Gene:Edf1 / 59022 MGIID:1891227 Length:154 Species:Mus musculus


Alignment Length:178 Identity:76/178 - (42%)
Similarity:99/178 - (55%) Gaps:46/178 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SDWDSVTVLRKKAPKSSTLKTESAVNQARRQGVAVDTQQKYGAGTNKQHVTTKNTAKLDRETEEL 66
            ||||:|||||||.|.::..|::.|:..|:|:|..|:|.:|:.||.||||..||||||||||||||
Mouse     4 SDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEEL 68

  Fly    67 RHDKIPLDVGKLIQQGRQSKGLSQKDLATKICEKQQVVTDYEAGRGIPNNLILGKMERVLGIKLR 131
            .||::.|:|||:||:|||||||:||||||         .....||      ..|.:.|      |
Mouse    69 HHDRVTLEVGKVIQRGRQSKGLTQKDLAT---------ASSSGGR------TSGSLSR------R 112

  Fly   132 GKERGQ-----PIAPPGKKXNDAAASAASGAPHTVTSGRSARQQNHQH 174
            |:.|.:     |:.|         |..:...|           |:|||
Mouse   113 GRRRNEHKASKPVVP---------AELSWLVP-----------QDHQH 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mbf1NP_001261952.1 MBF1 2..70 CDD:285695 41/67 (61%)
aMBF1 12..144 CDD:224726 61/136 (45%)
HTH_3 79..131 CDD:279690 19/51 (37%)
Edf1XP_030107780.1 MBF1 4..72 CDD:369924 41/67 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850745
Domainoid 1 1.000 92 1.000 Domainoid score I7612
eggNOG 1 0.900 - - E1_COG1813
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2809
Inparanoid 1 1.050 190 1.000 Inparanoid score I3874
Isobase 1 0.950 - 0 Normalized mean entropy S462
OMA 1 1.010 - - QHG54797
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003409
OrthoInspector 1 1.000 - - oto95114
orthoMCL 1 0.900 - - OOG6_102239
Panther 1 1.100 - - LDO PTHR10245
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R686
SonicParanoid 1 1.000 - - X2304
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.