DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mbf1 and edf1

DIOPT Version :9

Sequence 1:NP_001261952.1 Gene:mbf1 / 39842 FlyBaseID:FBgn0262732 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001016686.1 Gene:edf1 / 549440 XenbaseID:XB-GENE-975205 Length:148 Species:Xenopus tropicalis


Alignment Length:144 Identity:90/144 - (62%)
Similarity:118/144 - (81%) Gaps:0/144 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SDWDSVTVLRKKAPKSSTLKTESAVNQARRQGVAVDTQQKYGAGTNKQHVTTKNTAKLDRETEEL 66
            ||||:|||||||.|.::..|::.|:..|:|:|..|:|.:|:.||.||||..||||||||||||||
 Frog     4 SDWDTVTVLRKKGPTAAQAKSKQAITAAQRRGEEVETSKKWSAGQNKQHTITKNTAKLDRETEEL 68

  Fly    67 RHDKIPLDVGKLIQQGRQSKGLSQKDLATKICEKQQVVTDYEAGRGIPNNLILGKMERVLGIKLR 131
            .||::||:|||:||||||.||::||||||||.||.||:.|||:|:.||||.:|||:||.:|:|||
 Frog    69 HHDRVPLEVGKVIQQGRQGKGMNQKDLATKINEKPQVIADYESGKAIPNNQVLGKIERAIGLKLR 133

  Fly   132 GKERGQPIAPPGKK 145
            |::.|:|:.|..||
 Frog   134 GRDIGKPLDPIVKK 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mbf1NP_001261952.1 MBF1 2..70 CDD:285695 41/67 (61%)
aMBF1 12..144 CDD:224726 79/131 (60%)
HTH_3 79..131 CDD:279690 35/51 (69%)
edf1NP_001016686.1 MBF1 4..72 CDD:369924 41/67 (61%)
aMBF1 <77..146 CDD:331548 44/68 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 94 1.000 Domainoid score I7404
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2809
Inparanoid 1 1.050 188 1.000 Inparanoid score I3788
OMA 1 1.010 - - QHG54797
OrthoDB 1 1.010 - - D1571466at2759
OrthoFinder 1 1.000 - - FOG0003409
OrthoInspector 1 1.000 - - oto105299
Panther 1 1.100 - - LDO PTHR10245
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R686
SonicParanoid 1 1.000 - - X2304
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1313.110

Return to query results.
Submit another query.