DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mbf1 and SPBC83.17

DIOPT Version :9

Sequence 1:NP_001261952.1 Gene:mbf1 / 39842 FlyBaseID:FBgn0262732 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_595650.1 Gene:SPBC83.17 / 2541192 PomBaseID:SPBC83.17 Length:148 Species:Schizosaccharomyces pombe


Alignment Length:148 Identity:70/148 - (47%)
Similarity:92/148 - (62%) Gaps:3/148 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDWDSVTVLRKKA---PKSSTLKTESAVNQARRQGVAVDTQQKYGAGTNKQHVTTKNTAKLDRE 62
            |||||:||.:..:|   .::...||:|.:|.|||.|..|.|::||..|...|....::..|:|||
pombe     1 MSDWDTVTKIGSRAGPGARTHVAKTQSQINSARRAGAIVGTEKKYATGNKSQDPAGQHLTKIDRE 65

  Fly    63 TEELRHDKIPLDVGKLIQQGRQSKGLSQKDLATKICEKQQVVTDYEAGRGIPNNLILGKMERVLG 127
            .|..........|.:.||:|||:||.:||||:.:|.||.|||.|||:||.|||..:|.||||.||
pombe    66 NEVKPPSTTGRSVAQAIQKGRQAKGWAQKDLSQRINEKPQVVNDYESGRAIPNQQVLSKMERALG 130

  Fly   128 IKLRGKERGQPIAPPGKK 145
            |||||:..|.|:..|.||
pombe   131 IKLRGQNIGAPLGGPKKK 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mbf1NP_001261952.1 MBF1 2..70 CDD:285695 26/70 (37%)
aMBF1 12..144 CDD:224726 61/134 (46%)
HTH_3 79..131 CDD:279690 34/51 (67%)
SPBC83.17NP_595650.1 MBF1 2..73 CDD:285695 26/70 (37%)
aMBF1 8..148 CDD:224726 62/139 (45%)
HTH_XRE 82..134 CDD:197775 34/51 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 73 1.000 Domainoid score I2556
eggNOG 1 0.900 - - E1_COG1813
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2809
Inparanoid 1 1.050 133 1.000 Inparanoid score I1410
OMA 1 1.010 - - QHG54797
OrthoFinder 1 1.000 - - FOG0003409
OrthoInspector 1 1.000 - - oto102034
orthoMCL 1 0.900 - - OOG6_102239
Panther 1 1.100 - - LDO PTHR10245
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R686
SonicParanoid 1 1.000 - - X2304
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.