DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4229 and CG13033

DIOPT Version :9

Sequence 1:NP_648903.1 Gene:CG4229 / 39840 FlyBaseID:FBgn0036639 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_648902.1 Gene:CG13033 / 39839 FlyBaseID:FBgn0036638 Length:211 Species:Drosophila melanogaster


Alignment Length:260 Identity:88/260 - (33%)
Similarity:113/260 - (43%) Gaps:67/260 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VLTLSAVASVALGAPQLESRLRRDVSELVDPAAVEYLPPSVTEAVLLNAEPVEAEAHADPAALEA 73
            :..|.||.|:|    ...|.:|||||.|    .:|||||       :...||.:..:..|....|
  Fly     7 ICLLLAVVSLA----SCRSVVRRDVSHL----PLEYLPP-------VELPPVPSRDYLPPVEQHA 56

  Fly    74 DPEATVLGDEGYEYRTVRRLKLRHRNRRDVSHLQPARQYLPP-STAYLPPAQEAQAAPEAPAAAA 137
               ||                |.|       .|||.|.|||| :..||||..|.:...|.|.   
  Fly    57 ---AT----------------LNH-------VLQPPRDYLPPLNNEYLPPVVEEEQKQEVPT--- 92

  Fly   138 PPADDTEEVV-----SAAEPKVNREYLPPTEAAPAAEETTEAAAPEEPADVRVV-----DVPTVS 192
                 |.||:     :.||| .....:..||....||..||   |:|..:|:.|     :....|
  Fly    93 -----TTEVIIPEETTTAEP-TTEAVIITTEQPQEAEIITE---PQEEVEVKTVEEEEPEKEVES 148

  Fly   193 GQLLQDGYHYQQPAEMPAELREAAPEYLPPIGGEEVIVEGPAGGE-SAVLGSDGYQYRAIRRYRF 256
            ..||.|||||:.|:.:|..|  ...|||||:.|..|:.|.|.|.| |:.|..|||.||:::|.||
  Fly   149 AVLLDDGYHYRTPSVVPNLL--PVKEYLPPLDGNAVVEELPNGEEDSSALLDDGYHYRSVKRLRF 211

  Fly   257  256
              Fly   212  211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4229NP_648903.1 GYR 82..99 CDD:128953 2/16 (13%)
CG13033NP_648902.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450151
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F7D6
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.