DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4229 and CG32237

DIOPT Version :9

Sequence 1:NP_648903.1 Gene:CG4229 / 39840 FlyBaseID:FBgn0036639 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_729037.1 Gene:CG32237 / 38584 FlyBaseID:FBgn0052237 Length:911 Species:Drosophila melanogaster


Alignment Length:287 Identity:100/287 - (34%)
Similarity:136/287 - (47%) Gaps:81/287 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKIFSLGGVLTLSAVASVALGAPQLESRLRRDVSELVDPAAVEYLPPSVTEAVLLNAEPVEAEAH 65
            ||:| |..:...:|.|:|   .|..::|.||||||:|:    ||:||         ||.|.||..
  Fly     1 MKLF-LACIFIAAATAAV---IPVEQARHRRDVSEIVN----EYIPP---------AEEVGAELA 48

  Fly    66 ADPAALEADPEATVLGDEGYEYRTVRRLKLRHRNRRDVSHLQPARQYLPPSTAYLPPAQEAQAAP 130
            .||||         |||:||.|:|||||||  |.|||||.:         :..||||.:|..|  
  Fly    49 QDPAA---------LGDDGYRYKTVRRLKL--RQRRDVSEI---------ANEYLPPTEEVVA-- 91

  Fly   131 EAPAAAAPPADDTEE-VVSAAE------------------PKVNREYLPPTEAAPAAEETTEAAA 176
            :||....|..:.::: .|.||:                  ..:..|||||||     |...:|..
  Fly    92 DAPVEEVPVEEASQDSAVLAADGYQYKTVRRLKYRQRRDVSDIANEYLPPTE-----EVVADAPV 151

  Fly   177 PEEPADVRVVDVPTVSGQLLQDGYHYQQPAEMP----AELREAAPEYLPPIGGEEVIVEGP---- 233
            .|.|.:....|    |..|..|||.|:....:.    .::.|.|.|||||.  |||:.:.|    
  Fly   152 EEVPVEEASQD----SAVLAADGYKYKTVRRLKYRQRRDVSEIANEYLPPT--EEVVADTPVEEV 210

  Fly   234 ----AGGESAVLGSDGYQYRAIRRYRF 256
                |..:||||.:|||:|:.:||.::
  Fly   211 PVEEASQDSAVLAADGYKYKTVRRLKY 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4229NP_648903.1 GYR 82..99 CDD:128953 11/16 (69%)
CG32237NP_729037.1 GYR 56..73 CDD:128953 12/18 (67%)
GYR 168..185 CDD:128953 4/16 (25%)
GYR 224..241 CDD:128953 6/14 (43%)
GYR 336..353 CDD:128953
GYR 448..465 CDD:128953
GYR 616..633 CDD:128953
GYR 728..745 CDD:128953
GYR 892..909 CDD:128953
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450165
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008548
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.