DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13033 and CG11131

DIOPT Version :9

Sequence 1:NP_648902.1 Gene:CG13033 / 39839 FlyBaseID:FBgn0036638 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001262228.1 Gene:CG11131 / 40511 FlyBaseID:FBgn0037204 Length:229 Species:Drosophila melanogaster


Alignment Length:213 Identity:60/213 - (28%)
Similarity:82/213 - (38%) Gaps:61/213 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 PSRDYLPPV-EQHAATLN---------------HVLQ-PPRDYLPPLNN----EYLPPVVEEEQK 87
            ||.:||||| |..||.|:               |..: |.::||||:.|    ||||||      
  Fly    29 PSSEYLPPVGEAEAAQLSENGYKYRTVRRLKLRHRREVPNQEYLPPVENAPSQEYLPPV------ 87

  Fly    88 QEVPTTTEVIIPEETTTAE-----PTTEAVIITTEQPQEAEIITEPQEEVEVKTVEEEEPEKEVE 147
                   :.....:|..|:     .|...:.......::...|.||..|.......|..||.:  
  Fly    88 -------DAAAIGDTKVADDGYRYKTVRKLKFRARHRRDVSEIAEPSGEYLPPVQVELAPELK-- 143

  Fly   148 SAVLLDDGYHYRT---------------PSVVPNLLPVKEYLPPLD----GNAVVEELPNGEEDS 193
             .:|.||||.|:|               ........|..|||||.:    ..|..|..|...|:.
  Fly   144 -TILGDDGYKYKTVRRLKFRRHRREAVAEEAAAESAPNGEYLPPAEAAAAAPAAAEAEPKSAEEG 207

  Fly   194 SALLDDGYHYRSVKRLRF 211
            :.|..|||.|::|:|||:
  Fly   208 TELAKDGYRYKTVRRLRY 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13033NP_648902.1 None
CG11131NP_001262228.1 GYR 99..116 CDD:111632 1/16 (6%)
GYR 212..229 CDD:111632 8/14 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450160
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.