DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13033 and CG4229

DIOPT Version :9

Sequence 1:NP_648902.1 Gene:CG13033 / 39839 FlyBaseID:FBgn0036638 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_648903.1 Gene:CG4229 / 39840 FlyBaseID:FBgn0036639 Length:256 Species:Drosophila melanogaster


Alignment Length:260 Identity:88/260 - (33%)
Similarity:113/260 - (43%) Gaps:67/260 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ICLLLAVVSLA----SCRSVVRRDVSHL----PLEYLPP-------VELPPVPSRDYLPPVEQHA 56
            :..|.||.|:|    ...|.:|||||.|    .:|||||       :...||.:..:..|....|
  Fly     9 VLTLSAVASVALGAPQLESRLRRDVSELVDPAAVEYLPPSVTEAVLLNAEPVEAEAHADPAALEA 73

  Fly    57 ---AT----------------LNH-------VLQPPRDYLPPLNNEYLPPVVEEEQKQEVPT--- 92
               ||                |.|       .|||.|.|||| :..||||..|.:...|.|.   
  Fly    74 DPEATVLGDEGYEYRTVRRLKLRHRNRRDVSHLQPARQYLPP-STAYLPPAQEAQAAPEAPAAAA 137

  Fly    93 -----TTEVIIPEETTTAEP-TTEAVIITTEQPQEAEIITE---PQEEVEVKTVEEEEPEKEVES 148
                 |.||:     :.||| .....:..||....||..||   |:|..:|:.|     :....|
  Fly   138 PPADDTEEVV-----SAAEPKVNREYLPPTEAAPAAEETTEAAAPEEPADVRVV-----DVPTVS 192

  Fly   149 AVLLDDGYHYRTPSVVPNLL--PVKEYLPPLDGNAVVEELPNGEEDSSALLDDGYHYRSVKRLRF 211
            ..||.|||||:.|:.:|..|  ...|||||:.|..|:.|.|.|.| |:.|..|||.||:::|.||
  Fly   193 GQLLQDGYHYQQPAEMPAELREAAPEYLPPIGGEEVIVEGPAGGE-SAVLGSDGYQYRAIRRYRF 256

  Fly   212  211
              Fly   257  256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13033NP_648902.1 None
CG4229NP_648903.1 GYR 82..99 CDD:128953 2/16 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450151
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F7D6
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.