DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13033 and CG13705

DIOPT Version :9

Sequence 1:NP_648902.1 Gene:CG13033 / 39839 FlyBaseID:FBgn0036638 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_647938.1 Gene:CG13705 / 38587 FlyBaseID:FBgn0035582 Length:432 Species:Drosophila melanogaster


Alignment Length:257 Identity:77/257 - (29%)
Similarity:107/257 - (41%) Gaps:89/257 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RSVV--RRDVSHLPLEYLPPVE--------------------------------LPPVPSRDYLP 50
            |.|:  |||||.|..|||||||                                :..:||.:|||
  Fly   195 RRVIRRRRDVSELSPEYLPPVEESASEAVAVDTPLADDGYRYKTVRRVIRRRRDVNELPSGEYLP 259

  Fly    51 PVEQHAA-----------------TLNHVLQPPRDYLPPLNNEYLPPVVEEEQKQEVPTTTEVII 98
            |||:.|:                 |:..|::..|| :..|:.||||||  ||...|.       :
  Fly   260 PVEESASEAVAVETPLAADGYRYKTVRRVIRRRRD-VNELSAEYLPPV--EESASEA-------V 314

  Fly    99 PEETTTAE-----PTTEAVIITTEQPQEAEIITE---PQEEVEVKTVEEEEPEKEVESAVLLDDG 155
            ..||..|:     .|...||  ..:...:|:..|   |.||...:.|..|.|        |.|||
  Fly   315 AVETPLADDGYRYKTVRRVI--RRRRDVSELSPEYLPPVEESASEAVAVETP--------LADDG 369

  Fly   156 YHYRTPSVV------PNLLPVKEYLPPLDGNA-VVEELPNGEEDSSALLDDGYHYRSVKRLR 210
            |.|:|...|      .:.||..|||||::..| .:.::|   .:.:.|..|||.|::|:||:
  Fly   370 YRYKTVRRVIRRRRDVSELPSGEYLPPVEETASAIIDVP---AEQTVLASDGYRYKTVRRLK 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13033NP_648902.1 None
CG13705NP_647938.1 GYR 49..66 CDD:128953
GYR 417..432 CDD:128953 7/12 (58%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450158
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.