DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13033 and CG32237

DIOPT Version :9

Sequence 1:NP_648902.1 Gene:CG13033 / 39839 FlyBaseID:FBgn0036638 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_729037.1 Gene:CG32237 / 38584 FlyBaseID:FBgn0052237 Length:911 Species:Drosophila melanogaster


Alignment Length:305 Identity:79/305 - (25%)
Similarity:114/305 - (37%) Gaps:116/305 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLAVVSLASCRSVV--------RRDVSHLPLEYLPP-----VELPPVP---------------- 44
            |.||.:.:|:..:.|        |||||.:..||:||     .||...|                
  Fly     3 LFLACIFIAAATAAVIPVEQARHRRDVSEIVNEYIPPAEEVGAELAQDPAALGDDGYRYKTVRRL 67

  Fly    45 -----------SRDYLPPVEQHAA---------------------------TLNHVLQPPRDYLP 71
                       :.:||||.|:..|                           |:..:....|..:.
  Fly    68 KLRQRRDVSEIANEYLPPTEEVVADAPVEEVPVEEASQDSAVLAADGYQYKTVRRLKYRQRRDVS 132

  Fly    72 PLNNEYLPPVVEEEQKQEVPTTTEVIIPEETTTAEPTTEAVIITT--------------EQPQEA 122
            .:.||||||.  ||...:.|.       ||....|.:.::.::..              ::...:
  Fly   133 DIANEYLPPT--EEVVADAPV-------EEVPVEEASQDSAVLAADGYKYKTVRRLKYRQRRDVS 188

  Fly   123 EIITE---PQEEVEVKTVEEEEPEKEV--ESAVLLDDGYHYRT-----------PSVVPNLLPVK 171
            ||..|   |.|||...|..||.|.:|.  :||||..|||.|:|           .|.:.|     
  Fly   189 EIANEYLPPTEEVVADTPVEEVPVEEASQDSAVLAADGYKYKTVRRLKYRQRRDVSEIAN----- 248

  Fly   172 EYLPPLDG---NAVVEELP--NGEEDSSALLDDGYHYRSVKRLRF 211
            |||||.:.   .|.:||.|  ...:||:.|..|||.|::|:||::
  Fly   249 EYLPPTEDAATEAPIEEAPVEEASQDSAVLAADGYQYKTVRRLKY 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13033NP_648902.1 None
CG32237NP_729037.1 GYR 56..73 CDD:128953 0/16 (0%)
GYR 168..185 CDD:128953 0/16 (0%)
GYR 224..241 CDD:128953 5/16 (31%)
GYR 336..353 CDD:128953
GYR 448..465 CDD:128953
GYR 616..633 CDD:128953
GYR 728..745 CDD:128953
GYR 892..909 CDD:128953
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450164
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.