DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13033 and CG7465

DIOPT Version :9

Sequence 1:NP_648902.1 Gene:CG13033 / 39839 FlyBaseID:FBgn0036638 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_647909.1 Gene:CG7465 / 38553 FlyBaseID:FBgn0035551 Length:321 Species:Drosophila melanogaster


Alignment Length:278 Identity:74/278 - (26%)
Similarity:99/278 - (35%) Gaps:101/278 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLAVVSLASCRSVVRRDVSHLPL-EYLPPVELPPV---PSRDYLPPVE----------------- 53
            |:|...:|:    |..||||||. ||||||:...:   ||.:|||||:                 
  Fly     5 LVAFAVIAA----VAADVSHLPSNEYLPPVQEQQIIAGPSNEYLPPVQAESAPAHELADDGYRYK 65

  Fly    54 --------QHAATLNHVLQPPRDYLPPL---NNEYLPP---------------------VVEEEQ 86
                    :|...:|.:.   .:||||.   :||||.|                     ||....
  Fly    66 THKRVVVRRHRRDVNELF---NEYLPPFAAPSNEYLAPAEGAPETILADDGYRYKTHKRVVTRRH 127

  Fly    87 KQEVP--TTTEVIIPEETTTAE-----PTTEAVIITTEQPQEAEIITEPQEEVEVKTVEEEEPEK 144
            :::|.  .:.|.:.|.:.....     |.:..|.:....|...:|....|.......|.|.||..
  Fly   128 RRDVSHLPSNEYLPPVQAAAPSNEYLPPVSAPVQVAAPAPAPVQIAAPVQLAAPAPVVVEAEPAH 192

  Fly   145 EVESAVLLDDGYHYRTPSVV------------------PNLLPVKEYLPPLDGNAVVEELPNGEE 191
            |     |.||||.|:|...|                  |...|..|||.|      .|..|  |.
  Fly   193 E-----LADDGYRYKTHRRVVYRRHRRDVNELSNEYLPPFAAPSNEYLAP------AETAP--ET 244

  Fly   192 DSSALLDDGYHYRSVKRL 209
            |   |..|||.|::.||:
  Fly   245 D---LAVDGYRYKTHKRV 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13033NP_648902.1 None
CG7465NP_647909.1 GYR 111..128 CDD:128953 2/16 (13%)
GYR 249..265 CDD:128953 6/11 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450162
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.