DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment st and fetA

DIOPT Version :9

Sequence 1:NP_524108.1 Gene:st / 39836 FlyBaseID:FBgn0003515 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_415023.1 Gene:fetA / 946990 ECOCYCID:G6266 Length:225 Species:Escherichia coli


Alignment Length:188 Identity:50/188 - (26%)
Similarity:82/188 - (43%) Gaps:32/188 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 RIINNSTGAIQPGTLMALMGSSGSGKTTLMSTLA-FRQPAGTVVQGDILINGRRIG---PFMHRI 149
            :|:||...:::.|....:.|.||.||:||:..:| ...|    ..|.:|..|..:.   |.::|.
E. coli    21 KILNNINFSLRAGEFKLITGPSGCGKSTLLKIVASLISP----TSGTLLFEGEDVSTLKPEIYRQ 81

  Fly   150 S-GYVYQDDLFLGSLTVLEHLNFMAHLRLDRRVSKEERRLIIKELLERTGLLSAAQTRIGSGDDK 213
            . .|..|.....|. ||.::|.|...:|     :::....|..:.|||..|..:..|:     :.
E. coli    82 QVSYCAQTPTLFGD-TVYDNLIFPWQIR-----NRQPDPAIFLDFLERFALPDSILTK-----NI 135

  Fly   214 KVLSGGERKRLAFAVELLNNPVILFCDEPTTGLDS------------YSAQQLVATLY 259
            ..|||||::|::....|...|.:|..||.|:.||.            |..:|.:|.|:
E. coli   136 AELSGGEKQRISLIRNLQFMPKVLLLDEITSALDESNKHNVNEMIHRYVREQNIAVLW 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stNP_524108.1 ABCG_EPDR 66..298 CDD:213180 50/188 (27%)
3a01204 67..665 CDD:273361 50/188 (27%)
ABC2_membrane 395..600 CDD:279410
fetANP_415023.1 PRK10247 1..225 CDD:182331 50/188 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9743
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.