DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment st and ABCG39

DIOPT Version :9

Sequence 1:NP_524108.1 Gene:st / 39836 FlyBaseID:FBgn0003515 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_176867.2 Gene:ABCG39 / 843013 AraportID:AT1G66950 Length:1454 Species:Arabidopsis thaliana


Alignment Length:631 Identity:172/631 - (27%)
Similarity:282/631 - (44%) Gaps:138/631 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GSTIEVPSLDSTPKLSKRNSSERSLPLRSYSKWSPTEQGATLVWRDLCVYTNV-------GGSGQ 85
            ||.:|:.|  |:.|..||.   ..||.          |..:|.:.::..|.::       |..|.
plant   827 GSVVELNS--SSNKGPKRG---MVLPF----------QPLSLAFNNVNYYVDMPSEMKAQGVEGD 876

  Fly    86 RMKRIINNSTGAIQPGTLMALMGSSGSGKTTLMSTLAFRQPAGTVVQGDILING--RRIGPFMHR 148
            |: :::.:..||.:||.|.||:|.||:||||||..||.|:..| .::|.|.|:|  :....|. |
plant   877 RL-QLLRDVGGAFRPGILTALVGVSGAGKTTLMDVLAGRKTGG-YIEGSISISGYPKNQTTFA-R 938

  Fly   149 ISGYVYQDDLFLGSLTVLEHLNFMAHLRLDRRVSKEERRLIIKELLERTGLLSAAQTRIG-SGDD 212
            :|||..|:|:....:||.|.|.:.|.|||...:..:.|.|.::|::|...|.....:.:| .|.|
plant   939 VSGYCEQNDIHSPHVTVYESLIYSAWLRLSTDIDIKTRELFVEEVMELVELKPLRNSIVGLPGVD 1003

  Fly   213 KKVLSGGERKRLAFAVELLNNPVILFCDEPTTGLDSYSAQQLVATLYELAQKGTTILCTIHQPSS 277
            .  ||..:||||..||||:.||.|:|.||||:|||:.:|..::.|:......|.|::|||||||.
plant  1004 G--LSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSI 1066

  Fly   278 QLFDNFNNVMLL-ADGRVAFTGS----PQHALSFF--------ANHGYYCPEAYNPADFLIGVLA 329
            .:|::|:.::|: ..|:|.:.||    .|..:.:|        .|.|      ||||.:::.|  
plant  1067 DIFESFDELLLMKRGGQVIYAGSLGHHSQKLVEYFEAVEGVPKINDG------YNPATWMLDV-- 1123

  Fly   330 TDPGYEQASQRSAQHLCDQFAVSSAAKQRDMLVN-------------LEIHMAQSGNFPFDTEVE 381
            |.|..|  ||.|.. ....|:.||..::...|:.             .:...|||    |.|:.:
plant  1124 TTPSME--SQMSLD-FAQIFSNSSLYRRNQELIKDLSTPPPGSKDVYFKTKYAQS----FSTQTK 1181

  Fly   382 SFRGVAWYKRFHVVWLRASLTLLRDPTIQWLRFIQKIAMAFIIGACF--AGTTEPSQLGVQAVQG 444
            :    .::|::...|        |.|....:||:..:.:..:.|..|  .||...::..:....|
plant  1182 A----CFWKQYWSYW--------RHPQYNAIRFLMTVVIGVLFGLIFWQIGTKTENEQDLNNFFG 1234

  Fly   445 ALFIMI------SENTYHPMYSVLNLFPQGFPLFMRETRSGLYSTGQYYAANILALLPGMIIEPL 503
            |::..:      :..|..|..::..      .:|.||..:|:||...|..:.:...:....|:..
plant  1235 AMYAAVLFLGALNAATVQPAIAIER------TVFYREKAAGMYSAIPYAISQVAVEIMYNTIQTG 1293

  Fly   504 IFVIICYWLTGLRST------FYAFGVTA---------MCVVLVMN--VATACGCFFSTAFNSVP 551
            ::.:|.|.:.|...|      ||.:.:|:         |.:.|..|  :|..|..||.:.:|   
plant  1294 VYTLILYSMIGCNWTMAKFLWFYYYMLTSFIYFTLYGMMLMALTPNYQIAGICMSFFLSLWN--- 1355

  Fly   552 LAMAYLVPLDYIFMITSGIFIQVNSLPVAFWWTQF-----LSWMLY 592
                          :.||..|....:|:  ||..:     ::|.||
plant  1356 --------------LFSGFLIPRPQIPI--WWRWYYWATPVAWTLY 1385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stNP_524108.1 ABCG_EPDR 66..298 CDD:213180 89/242 (37%)
3a01204 67..665 CDD:273361 161/592 (27%)
ABC2_membrane 395..600 CDD:279410 45/228 (20%)
ABCG39NP_176867.2 PLN03140 14..1454 CDD:215599 172/631 (27%)
ABC_trans_N 94..169 CDD:291196
P-loop_NTPase 180..430 CDD:304359
ABC2_membrane 531..737 CDD:279410
PDR_assoc 744..810 CDD:285559
ABCG_PDR_domain2 850..1088 CDD:213199 89/242 (37%)
ABC2_membrane 1183..1388 CDD:279410 46/236 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X52
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.