DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment st and ABCA8

DIOPT Version :9

Sequence 1:NP_524108.1 Gene:st / 39836 FlyBaseID:FBgn0003515 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_190363.3 Gene:ABCA8 / 823933 AraportID:AT3G47790 Length:901 Species:Arabidopsis thaliana


Alignment Length:311 Identity:83/311 - (26%)
Similarity:141/311 - (45%) Gaps:39/311 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VEAPERVEQH--ELQVMPVGSTIEVPSLDSTPKLSKRNSSERSLPLRSYSKWSPTEQGATLVWRD 73
            :::..:.:||  :.::..|...:|.|.:     ..:|...|:.| |:|      |...|.|....
plant   539 LQSTSKKKQHFSDNKISKVVVEMEKPDV-----CREREKVEQCL-LKS------TRDSAVLCNNL 591

  Fly    74 LCVYTNVGGSGQRMKRIINNSTGAIQPGTLMALMGSSGSGKTTL--MSTLAFRQPAGTV-VQG-D 134
            ..||:  |..|...|..:...:.|:..|....::|.:|:|||:.  |.|...:..:||. ||| |
plant   592 KKVYS--GKDGNPQKLAVRGLSLALPQGECFGMLGPNGAGKTSFINMMTGIIKPSSGTAFVQGLD 654

  Fly   135 ILINGRRIGPFMHRISGYVYQDDLFLGSLTVLEHLNFMAHLRLDRRVSKEERRLIIKELLERTGL 199
            ||.:..||    :...|...|.||....|:..|||.|...|       |..:..::.:.:|.:  
plant   655 ILTDMDRI----YTTIGVCPQHDLLWEKLSGREHLLFYGRL-------KNLKGSVLTQAVEES-- 706

  Fly   200 LSAAQTRIGSGDDKKV--LSGGERKRLAFAVELLNNPVILFCDEPTTGLDSYSAQQLVATLYELA 262
            |.:.....|...||:|  .|||.::||:.|:.|:.:|.:::.|||:||||..|.:.|...:....
plant   707 LRSVNLFHGGIGDKQVSKYSGGMKRRLSVAISLIGSPKVVYMDEPSTGLDPASRKSLWDVVKRAK 771

  Fly   263 QKGTTILCTIHQPSSQLFDNFNNVMLLADGRVAFTGSPQHALSFFANHGYY 313
            :||..||.|.....:::.  .:.:.:..||.:...|:|:...|.:.  |.|
plant   772 RKGAIILTTHSMEEAEIL--CDRIGIFVDGSLQCIGNPKELKSRYG--GSY 818

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stNP_524108.1 ABCG_EPDR 66..298 CDD:213180 67/237 (28%)
3a01204 67..665 CDD:273361 72/253 (28%)
ABC2_membrane 395..600 CDD:279410
ABCA8NP_190363.3 ABC2_membrane_3 <247..488 CDD:289468
BI-1-like 367..>451 CDD:294323
CcmA 585..897 CDD:224054 72/253 (28%)
ABC_subfamily_A 590..811 CDD:213230 67/237 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.