DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment st and AT3G21080

DIOPT Version :9

Sequence 1:NP_524108.1 Gene:st / 39836 FlyBaseID:FBgn0003515 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_188745.1 Gene:AT3G21080 / 821660 AraportID:AT3G21080 Length:255 Species:Arabidopsis thaliana


Alignment Length:145 Identity:31/145 - (21%)
Similarity:53/145 - (36%) Gaps:48/145 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   486 YYAANILALLPGMIIEPLIFVIICY---WLTGLRSTFYAFGVTAMCVVLVMNVATACG------- 540
            |.:.|:..:|...:||.|:.|:..:   :||||   |...|       |:..:.|:.|       
plant    93 YKSGNLPGVLSFSVIEILMMVVASFVPNFLTGL---FTGAG-------LIGIIMTSSGFSRLLPD 147

  Fly   541 -----CFFSTA-------FNSVPLAMA----YLVPLDYIFMITSGIFIQVNSLPV----AFWW-- 583
                 |.||.:       |.|..:.:.    :|.||.......:|..:.:|...|    :.||  
plant   148 LPKIFCRFSISYTISYMIFGSWAIKLGHNNNFLGPLSPDEPKMTGEEMNMNEFGVKVTHSGWWGF 212

  Fly   584 ------TQFLSWMLY 592
                  ....:|:|:
plant   213 PEIVIAILVCTWLLF 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stNP_524108.1 ABCG_EPDR 66..298 CDD:213180
3a01204 67..665 CDD:273361 31/145 (21%)
ABC2_membrane 395..600 CDD:279410 31/145 (21%)
AT3G21080NP_188745.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0061
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000053
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.