DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment st and AgaP_AGAP009470

DIOPT Version :9

Sequence 1:NP_524108.1 Gene:st / 39836 FlyBaseID:FBgn0003515 Length:666 Species:Drosophila melanogaster
Sequence 2:XP_559779.3 Gene:AgaP_AGAP009470 / 3291976 VectorBaseID:AGAP009470 Length:226 Species:Anopheles gambiae


Alignment Length:217 Identity:51/217 - (23%)
Similarity:92/217 - (42%) Gaps:36/217 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   465 FPQGFPLFMRETRSGLYSTGQYYAANILALLPGMIIEPLIFVIICYWLTGLRSTFYAFGVTAMCV 529
            ||....:|:||..:..||...||.:.::|..|.:|:.|.:|:...|:||........       :
Mosquito    27 FPLETSVFVRERMNNWYSLKAYYFSKLVADFPFLILGPSVFLAGAYYLTSQPMELDR-------I 84

  Fly   530 VLVMNVATACGCFFST---------AFNSVPLAMA-YLVPLDYI-FMITSGIFIQVNSL---PVA 580
            |::.::     |.|::         |.:.:||.:: :.||...| .:|..|.|::...:   .:.
Mosquito    85 VMLWSI-----CIFTSWIAQMTGLLAGSVLPLELSVFCVPCSVIPMLIFCGFFVRFREMFDFLIP 144

  Fly   581 FWWTQFLSWMLYANE-AMTAAQWSGVQNITCFQESADLPCFHTGQDVLDKYSFNESNVYRNLLAM 644
            |   .::::..|:.| ||.|.......|:.|   |.|...|......||.:...|:....::..:
Mosquito   145 F---TYVAYFRYSFEGAMQAIYGFDRANLPC---SGDFCYFSKVPKFLDSFDMLENTFVMDVCGL 203

  Fly   645 VGLYFGFHLLGYYC--LWRRAR 664
            :|..|..| :|.|.  .||..|
Mosquito   204 LGWIFVLH-VGLYASLAWRLKR 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stNP_524108.1 ABCG_EPDR 66..298 CDD:213180
3a01204 67..665 CDD:273361 51/217 (24%)
ABC2_membrane 395..600 CDD:279410 34/149 (23%)
AgaP_AGAP009470XP_559779.3 ABC2_membrane <18..161 CDD:279410 34/148 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0061
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000053
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.