DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment st and CG34120

DIOPT Version :9

Sequence 1:NP_524108.1 Gene:st / 39836 FlyBaseID:FBgn0003515 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_001285513.1 Gene:CG34120 / 318066 FlyBaseID:FBgn0083956 Length:1998 Species:Drosophila melanogaster


Alignment Length:274 Identity:65/274 - (23%)
Similarity:116/274 - (42%) Gaps:73/274 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 DLCVYTNVGGSGQRMKRIINNSTGAIQPGTL---------------------------------M 104
            ||.:|..:|.:.||.|:..|.|...:....|                                 .
  Fly   822 DLLLYAVIGLAYQRYKKTDNYSFVKVSRSQLDGKLGASLVNVSKLYGSKCAVSNLSLDFARNQVS 886

  Fly   105 ALMGSSGSGKTTLMSTLA--FRQPAGTVVQGDILINGRRIGPFMHRISGYVYQDDLFLGSLTVLE 167
            .|:|.:|:||:||:..|.  .||.:|.|     |:.|.      |:: |..:||::.:.:||..|
  Fly   887 CLLGRNGAGKSTLIKLLTGQIRQSSGKV-----LLAGE------HQV-GVCWQDNILIPTLTARE 939

  Fly   168 HLNFMAHLRLDRRVS--KEERRLIIKELLERTGLLSAAQTRIGSGDDKKV----LSGGERKRLAF 226
            ||...|.:::....|  .||.|..:.:.|:          .:..|..:..    ||||.|:||..
  Fly   940 HLQLYAQIKIPPGGSGGVEEIRSEVAQTLQ----------SLNFGKHESYPSWQLSGGYRRRLCV 994

  Fly   227 AVELLNNPVILFCDEPTTGLDSYSAQQLVATLYELAQKGTTILCTIH--QPSSQLFDNFNNVMLL 289
            |:..:.:|.::..|||..|:|: .|::.:..|.|..::|..::...|  ..:..|.|   :::::
  Fly   995 AIAFIASPSVVILDEPCNGVDA-KARKDIWQLIERLRQGRAVIFATHFMDEAKYLSD---SLVIM 1055

  Fly   290 ADGRVAFTGSPQHA 303
            .:||:.    .||:
  Fly  1056 RNGRII----AQHS 1065

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stNP_524108.1 ABCG_EPDR 66..298 CDD:213180 63/267 (24%)
3a01204 67..665 CDD:273361 65/274 (24%)
ABC2_membrane 395..600 CDD:279410
CG34120NP_001285513.1 ABC2_membrane_3 <621..760 CDD:289468
ABC_subfamily_A 859..1073 CDD:213230 55/237 (23%)
drrA 865..1162 CDD:130256 55/231 (24%)
ABC2_membrane_3 1230..1601 CDD:289468
Mem_trans 1436..>1552 CDD:304621
ABC_subfamily_A 1651..1857 CDD:213230
drrA 1666..1945 CDD:130256
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.