DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment st and Abca1

DIOPT Version :9

Sequence 1:NP_524108.1 Gene:st / 39836 FlyBaseID:FBgn0003515 Length:666 Species:Drosophila melanogaster
Sequence 2:XP_038965774.1 Gene:Abca1 / 313210 RGDID:631344 Length:2263 Species:Rattus norvegicus


Alignment Length:359 Identity:86/359 - (23%)
Similarity:156/359 - (43%) Gaps:57/359 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 QRMKRIINNSTGAIQPGTLMALMGSSGSGKTTLMSTLAFRQPAG--TVVQGDILINGRRIGPFMH 147
            ::.|..::.....|.||....|:|.:|:|||:     .|:...|  .|.:||.|:|...|...:|
  Rat  1925 RKRKPAVDRICVGIPPGECFGLLGVNGAGKTS-----TFKMLTGDTAVTRGDALLNKNSILSNIH 1984

  Fly   148 RI---SGYVYQDDLFLGSLTVLEHLNFMAHLRLDRRVSKEERRLIIKELLERTGLLSAAQTRIGS 209
            .:   .||..|.|.....||..|||.|.|.|   |.|.::|...:.:..:.:.||:...:....:
  Rat  1985 EVHQNMGYCPQFDAITELLTGREHLEFFALL---RGVPEKEVGKVGEWAIRKLGLVKYGEKYASN 2046

  Fly   210 GDDKKVLSGGERKRLAFAVELLNNPVILFCDEPTTGLDSYSAQQLVATLYELAQKGTTILCTIHQ 274
                  .|||.:::|:.|:.|:..|.::|.||||||:|..:.:.|......:.::|.:::.|.|.
  Rat  2047 ------YSGGNKRKLSTAIALIGGPPVVFLDEPTTGMDPKARRFLWNCALSIIKEGRSVVLTSHS 2105

  Fly   275 PSSQLFDNFNNVMLLADGRVAFTGSPQHALSFFANHGYYC--------PEAYNPADFLIGVLATD 331
             ..:.......:.::.:||....||.||..:.|.: ||..        |: ..|.....|:  ..
  Rat  2106 -MEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGD-GYTIVVRIAGSNPD-LKPVQEFFGL--AF 2165

  Fly   332 PG------------YEQASQRSAQHLCDQFAVSSAAKQRDMLVNLEIHMAQSG-------NFPFD 377
            ||            |:..|..|:  |...|::.|.:|:|   :::|.:.....       ||..|
  Rat  2166 PGSVLKEKHRNMLQYQLPSSLSS--LARIFSILSQSKKR---LHIEDYSVSQTTLDQVFVNFAKD 2225

  Fly   378 -TEVESFRGVAWYKRFHVVWLRASLTLLRDPTIQ 410
             ::.:..:.::.:|...||.:....:.|:|..::
  Rat  2226 QSDDDHLKDLSLHKNQTVVDVAVLTSFLQDEKVK 2259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stNP_524108.1 ABCG_EPDR 66..298 CDD:213180 57/217 (26%)
3a01204 67..665 CDD:273361 86/359 (24%)
ABC2_membrane 395..600 CDD:279410 3/16 (19%)
Abca1XP_038965774.1 rim_protein 1..2238 CDD:130324 81/336 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.