DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment st and Abca7

DIOPT Version :9

Sequence 1:NP_524108.1 Gene:st / 39836 FlyBaseID:FBgn0003515 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_997481.1 Gene:Abca7 / 299609 RGDID:1303134 Length:2170 Species:Rattus norvegicus


Alignment Length:382 Identity:101/382 - (26%)
Similarity:151/382 - (39%) Gaps:74/382 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 QHELQVMPVGSTIEVPSLDSTPKLSKRNSS---ERSLPLRSYSKWSPTEQGATLVWRDLC-VYTN 79
            ||..:::|      .|.....|.|.:.:..   ||....:.      ..||..||.|||. ||  
  Rat  1777 QHRNRLLP------QPKSRLPPPLGEEDEDVVRERERVTKG------ATQGDVLVLRDLTKVY-- 1827

  Fly    80 VGGSGQRMKRIINNSTGAIQPGTLMALMGSSGSGKTTLMSTLAFRQPAGTVV--QGDILINGRRI 142
               .|||...:.:...| |.||....|:|.:|:|||:     .||...|..:  .|:.::.|..:
  Rat  1828 ---RGQRSPAVDHLCLG-IPPGECFGLLGVNGAGKTS-----TFRMVTGDTLPSSGEAVLAGHNV 1883

  Fly   143 G---PFMHRISGYVYQDDLFLGSLTVLEHLNFMAHLRLDRRVSKEERRLIIKEL--LERTGLLSA 202
            .   ...||..||..|.|.....||..|||...|.||     ...|.::....|  |.|.||.|.
  Rat  1884 AQEPSAAHRSMGYCPQSDAIFDLLTGREHLELFARLR-----GVPEAQVAQTALSGLVRLGLPSY 1943

  Fly   203 AQTRIGSGDDKKVLSGGERKRLAFAVELLNNPVILFCDEPTTGLDSYSAQQLVATLYELAQKGTT 267
            |....|:      .|||.:::||.|:.|:.:|.::|.||||||:|..:.:.|...|..:.::|.:
  Rat  1944 ADRPAGT------YSGGNKRKLATALALVGDPAVVFLDEPTTGMDPSARRFLWNNLLSVVREGRS 2002

  Fly   268 ILCTIHQPSSQLFDNFNNVMLLADGRVAFTGSPQHALS-FFANHGYYC---PEAYNPADFLIGVL 328
            ::.|.|. ..:.......:.::.:||....||.||..| |.|.|....   |:...||...|...
  Rat  2003 VVLTSHS-MEECEALCTRLAIMVNGRFRCLGSAQHLKSRFGAGHTLTLRVPPDQPEPAIAFIVTT 2066

  Fly   329 ATD----------------PG--------YEQASQRSAQHLCDQFAVSSAAKQRDML 361
            ..|                ||        :.:.:.:...|..:.|:||....:...|
  Rat  2067 FPDAELREVHGSRLRFQLPPGGGCTLARVFRELAAQGKAHGVEDFSVSQTTLEEVFL 2123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stNP_524108.1 ABCG_EPDR 66..298 CDD:213180 72/239 (30%)
3a01204 67..665 CDD:273361 91/331 (27%)
ABC2_membrane 395..600 CDD:279410
Abca7NP_997481.1 rim_protein 1..2127 CDD:130324 101/382 (26%)
ABC2_membrane <557..742 CDD:304374
ABC_subfamily_A 805..1024 CDD:213230
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1044..1086
ABC_subfamily_A 1818..2038 CDD:213230 75/242 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2129..2170
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.