DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment st and ABCA3

DIOPT Version :9

Sequence 1:NP_524108.1 Gene:st / 39836 FlyBaseID:FBgn0003515 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_001080.2 Gene:ABCA3 / 21 HGNCID:33 Length:1704 Species:Homo sapiens


Alignment Length:530 Identity:123/530 - (23%)
Similarity:206/530 - (38%) Gaps:107/530 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 DSTPKLSKRNSSERSLPLRSYSKWSPTEQGATLVWRDLCVYTNVGGSGQRMKRIINNSTGAIQPG 101
            ||.|:.:.||         .|.:..|.:..|.:..:.|.....||...:...|.:|.:   :..|
Human   507 DSDPEKALRN---------EYFEAEPEDLVAGIKIKHLSKVFRVGNKDRAAVRDLNLN---LYEG 559

  Fly   102 TLMALMGSSGSGKTTLMSTLAFRQPAGTVVQGDILINGRRIGPFMHRIS---GYVYQDDLFLGSL 163
            .:..|:|.:|:||||.:|.|....|.   ..|...|:|..|...|.:|.   |...|.|:...:|
Human   560 QITVLLGHNGAGKTTTLSMLTGLFPP---TSGRAYISGYEISQDMVQIRKSLGLCPQHDILFDNL 621

  Fly   164 TVLEHLNFMAHLR-LDRRVSKEERRLIIKELLERTGLLSAAQTRIGSGDDKKVLSGGERKRLAFA 227
            ||.|||.|.|.|: |.|:...||    :|::|...||.....:|      .:.||||.|::|:..
Human   622 TVAEHLYFYAQLKGLSRQKCPEE----VKQMLHIIGLEDKWNSR------SRFLSGGMRRKLSIG 676

  Fly   228 VELLNNPVILFCDEPTTGLDSYSAQQLVATLYELAQKGTTILCTIHQPSSQLFDNFNNVMLLADG 292
            :.|:....:|..||||:|:|:.|.:.:...|.......|.:|.|.....:.|..  :.:.::|.|
Human   677 IALIAGSKVLILDEPTSGMDAISRRAIWDLLQRQKSDRTIVLTTHFMDEADLLG--DRIAIMAKG 739

  Fly   293 RVAFTGSPQHALSFFANHGY------------YCPEAYNPADFLIGVLATDPGYEQASQRSAQHL 345
            .:...||     |.|....|            :|    ||.|.              ||....|:
Human   740 ELQCCGS-----SLFLKQKYGAGYHMTLVKEPHC----NPEDI--------------SQLVHHHV 781

  Fly   346 CDQFAVSSAAKQRDMLVNLEIHMAQSGNFPFDTEVESFRGVAWY----KRFHVVWLRA------- 399
            .:....|||..:...::..|......|.|....:.:...|:|.:    .....|:||.       
Human   782 PNATLESSAGAELSFILPRESTHRFEGLFAKLEKKQKELGIASFGASITTMEEVFLRVGKLVDSS 846

  Fly   400 -SLTLLRDPTIQWLRFIQKIAMAFIIGACFAGTTEPSQLGVQAVQGALFIMISENTYHPMYSVLN 463
             .:..::.|.:|:..  ::.|..:.:.:...|..:||. |:    |||  :..|.|...:.:.|.
Human   847 MDIQAIQLPALQYQH--ERRASDWAVDSNLCGAMDPSD-GI----GAL--IEEERTAVKLNTGLA 902

  Fly   464 LFPQGF-PLFMRETRSGLYSTGQYYAANILALLPGMIIEPLIFVIICYWLTG----------LRS 517
            |..|.| .:|:::   ..||..::      .::...::.||..|.:......          ||.
Human   903 LHCQQFWAMFLKK---AAYSWREW------KMVAAQVLVPLTCVTLALLAINYSSELFDDPMLRL 958

  Fly   518 TFYAFGVTAM 527
            |...:|.|.:
Human   959 TLGEYGRTVV 968

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stNP_524108.1 ABCG_EPDR 66..298 CDD:213180 66/235 (28%)
3a01204 67..665 CDD:273361 116/500 (23%)
ABC2_membrane 395..600 CDD:279410 30/152 (20%)
ABCA3NP_001080.2 ABC2_membrane_3 <271..469 CDD:289468
CcmA 530..839 CDD:224054 87/349 (25%)
ABC_subfamily_A 530..751 CDD:213230 69/243 (28%)
ABC2_membrane_3 923..1261 CDD:289468 8/52 (15%)
ABC_subfamily_A 1381..1602 CDD:213230
drrA 1397..1692 CDD:130256
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.