DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment st and ABCA1

DIOPT Version :9

Sequence 1:NP_524108.1 Gene:st / 39836 FlyBaseID:FBgn0003515 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_005493.2 Gene:ABCA1 / 19 HGNCID:29 Length:2261 Species:Homo sapiens


Alignment Length:359 Identity:86/359 - (23%)
Similarity:158/359 - (44%) Gaps:57/359 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 QRMKRIINNSTGAIQPGTLMALMGSSGSGKTTLMSTLAFRQPAG--TVVQGDILINGRRIGPFMH 147
            ::.|..::.....|.||....|:|.:|:||::     .|:...|  ||.:||..:|...|...:|
Human  1923 RKRKPAVDRICVGIPPGECFGLLGVNGAGKSS-----TFKMLTGDTTVTRGDAFLNKNSILSNIH 1982

  Fly   148 RI---SGYVYQDDLFLGSLTVLEHLNFMAHLRLDRRVSKEERRLIIKELLERTGLLSAAQTRIGS 209
            .:   .||..|.|.....||..||:.|.|.|   |.|.::|...:.:..:.:.||:...:...|:
Human  1983 EVHQNMGYCPQFDAITELLTGREHVEFFALL---RGVPEKEVGKVGEWAIRKLGLVKYGEKYAGN 2044

  Fly   210 GDDKKVLSGGERKRLAFAVELLNNPVILFCDEPTTGLDSYSAQQLVATLYELAQKGTTILCTIHQ 274
                  .|||.:::|:.|:.|:..|.::|.||||||:|..:.:.|......:.::|.:::.|.|.
Human  2045 ------YSGGNKRKLSTAMALIGGPPVVFLDEPTTGMDPKARRFLWNCALSVVKEGRSVVLTSHS 2103

  Fly   275 PSSQLFDNFNNVMLLADGRVAFTGSPQHALSFFANHGYYC--------PEAYNPADFLIGVLATD 331
             ..:.......:.::.:||....||.||..:.|.: ||..        |:.....|| .|:  ..
Human  2104 -MEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGD-GYTIVVRIAGSNPDLKPVQDF-FGL--AF 2163

  Fly   332 PG------------YEQASQRSAQHLCDQFAVSSAAKQRDMLVNLEIHMAQSG-------NFPFD 377
            ||            |:..|..|:  |...|::.|.:|:|   :::|.:.....       ||..|
Human  2164 PGSVLKEKHRNMLQYQLPSSLSS--LARIFSILSQSKKR---LHIEDYSVSQTTLDQVFVNFAKD 2223

  Fly   378 -TEVESFRGVAWYKRFHVVWLRASLTLLRDPTIQ 410
             ::.:..:.::.:|...||.:....:.|:|..::
Human  2224 QSDDDHLKDLSLHKNQTVVDVAVLTSFLQDEKVK 2257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stNP_524108.1 ABCG_EPDR 66..298 CDD:213180 56/217 (26%)
3a01204 67..665 CDD:273361 86/359 (24%)
ABC2_membrane 395..600 CDD:279410 3/16 (19%)
ABCA1NP_005493.2 rim_protein 6..2236 CDD:130324 81/336 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1283..1312
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.