DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment st and Abca2

DIOPT Version :9

Sequence 1:NP_524108.1 Gene:st / 39836 FlyBaseID:FBgn0003515 Length:666 Species:Drosophila melanogaster
Sequence 2:XP_006497672.1 Gene:Abca2 / 11305 MGIID:99606 Length:2464 Species:Mus musculus


Alignment Length:413 Identity:90/413 - (21%)
Similarity:162/413 - (39%) Gaps:101/413 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PERVEQHELQVMPVGSTIEVPSLDSTPKLSKRNSSERSLPLRSYSK-WSPTEQGATLVWRDLCVY 77
            |:|:   .:...||...::|.|  ...::.:.::....:.:.:.:| :...:.|..|....||: 
Mouse  2048 PQRL---PVSTKPVEDDVDVAS--ERQRVLRGDADNDMVKIENLTKVYKSRKIGRILAVDRLCL- 2106

  Fly    78 TNVGGSGQRMKRIINNSTGAIQPGTLMALMGSSGSGKTTLMSTLAFRQPAG--TVVQGDILINGR 140
                               .::||....|:|.:|:|||:     .|:...|  :...|:..:||.
Mouse  2107 -------------------GVRPGECFGLLGVNGAGKTS-----TFKMLTGDESTTGGEAFVNGH 2147

  Fly   141 RIGPFMHRIS---GYVYQDDLFLGSLTVLEHLNFMAHLRLDRRVSKEERRLIIKELLERTGLLSA 202
            .:...:.::.   ||..|.|.....||..|||.....|   |.:..::...::|..||:..|...
Mouse  2148 SVLKDLLQVQQSLGYCPQFDALFDELTAREHLQLYTRL---RGIPWKDEAQVVKWALEKLELTKY 2209

  Fly   203 AQTRIGSGDDKKVLSGGERKRLAFAVELLNNPVILFCDEPTTGLDSYSAQQLVATLYELAQKGTT 267
            |....|:      .|||.:::|:.|:.|:..|..:|.||||||:|..:.:.|...:.:|.:.|.:
Mouse  2210 ADKPAGT------YSGGNKRKLSTAIALIGYPAFIFLDEPTTGMDPKARRFLWNLILDLIKTGRS 2268

  Fly   268 ILCTIHQPSSQLFDNFNNVMLLADGRVAFTGSPQHALSFFANHGYYC------------------ 314
            ::.|.|. ..:.......:.::.:||:...||.||..:.|.: ||..                  
Mouse  2269 VVLTSHS-MEECEALCTRLAIMVNGRLRCLGSIQHLKNRFGD-GYMITVRTKSSQNVKDVVRFFN 2331

  Fly   315 ---PEA------------------------YNPADFLIGVLATDPGYEQASQRSAQHLCDQFAVS 352
               |||                        ::..:.::|||    |.|..|  .:|...|...|:
Mouse  2332 RNFPEAMLKERHHTKVQYQLKSEHISLAQVFSKMEQVVGVL----GIEDYS--VSQTTLDNVFVN 2390

  Fly   353 SAAKQRDMLVNLEIHMAQSGNFP 375
            .|.||.|   |:|...|:..:.|
Mouse  2391 FAKKQSD---NVEQQEAEPSSLP 2410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stNP_524108.1 ABCG_EPDR 66..298 CDD:213180 56/236 (24%)
3a01204 67..665 CDD:273361 82/359 (23%)
ABC2_membrane 395..600 CDD:279410
Abca2XP_006497672.1 rim_protein 58..2398 CDD:130324 86/399 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.