DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43373 and Gucy1a1

DIOPT Version :9

Sequence 1:NP_001097622.2 Gene:CG43373 / 39835 FlyBaseID:FBgn0263131 Length:1854 Species:Drosophila melanogaster
Sequence 2:NP_001343916.1 Gene:Gucy1a1 / 60596 MGIID:1926562 Length:691 Species:Mus musculus


Alignment Length:393 Identity:96/393 - (24%)
Similarity:166/393 - (42%) Gaps:93/393 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   583 FNGSACCIVLIYMTYTMLPLRLREALIGGILLSVVHLYTCLRLNAMQDEAVEMIHWEELLCTLVA 647
            |.||.|..            ||.:....|:.||.:.::     ||::|                .
Mouse   381 FLGSPCVD------------RLEDFTGRGLYLSDIPIH-----NALRD----------------V 412

  Fly   648 LLLANLTGVYTHWPKEKAQRKAFIETRQCIEARLRTQRENQQQERLLLSVLPRHVAMEMKDDIAG 712
            :|:...........|...:.||.:|     .|....:.|.::...||.|:.|..||.::      
Mouse   413 VLIGEQARAQDGLKKRLGKLKATLE-----HAHQALEEEKKRTVDLLCSIFPSEVAQQL------ 466

  Fly   713 QPRDTQFHKIYIQRHENVSILFADICGFTSLSDQCTAEELVRLLNELFARFDRLAAEHHCLRIKL 777
                .|...:..::...|::||:||.|||::..||:..:::.:||.|:.|||:...|....:::.
Mouse   467 ----WQGQIVQAKKFSEVTMLFSDIVGFTAICSQCSPLQVITMLNALYTRFDQQCGELDVYKVET 527

  Fly   778 LGDCYYCVSGLPEPRPDHAHCAVEMGLDMIDAIALVREVMAVN---VNMRVGIHTGRVHCGVLGL 839
            :||.|....||......|   ||::.|..:..:.|..|||:.:   :.||:|:|:|.|..||:|:
Mouse   528 IGDAYCVAGGLHRESDTH---AVQIALMALKMMELSNEVMSPHGEPIKMRIGLHSGSVFAGVVGV 589

  Fly   840 VKWQFDVWSNDVTLANHMESGGIPGRVHITKETLKCLDGDYEVEVGKGNERNSYLKDHQIETYLI 904
            ...::.::.|:|||||..||..:|.:::::..|.:                  .|||        
Mouse   590 KMPRYCLFGNNVTLANKFESCSVPRKINVSPTTYR------------------LLKD-------- 628

  Fly   905 VPGDIYRPHKKSRNRLQVNGNISKELRMMGHGTAQKH----TSKFGFGDSSESAKDPEDEVNEYL 965
            .||.::.|    |:|.::..|...::..:.|.....|    .||..|.|     ||.||....:|
Mouse   629 CPGFVFTP----RSREELPPNFPSDIPGICHFLDAYHHQGPNSKPWFQD-----KDVEDGNANFL 684

  Fly   966 MRA 968
            .:|
Mouse   685 GKA 687

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43373NP_001097622.2 AC_N <523..720 CDD:292831 26/136 (19%)
CYCc 686..881 CDD:214485 57/197 (29%)
Guanylate_cyc 722..895 CDD:278633 49/175 (28%)
DUF1053 <949..1005 CDD:283888 7/20 (35%)
CYCc 1259..1455 CDD:214485
Guanylate_cyc 1285..1479 CDD:278633
Gucy1a1NP_001343916.1 HNOBA 277..466 CDD:311573 25/122 (20%)
Guanylate_cyc 472..643 CDD:306677 57/203 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.