DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43373 and NPR2

DIOPT Version :9

Sequence 1:NP_001097622.2 Gene:CG43373 / 39835 FlyBaseID:FBgn0263131 Length:1854 Species:Drosophila melanogaster
Sequence 2:XP_024303324.1 Gene:NPR2 / 4882 HGNCID:7944 Length:1103 Species:Homo sapiens


Alignment Length:243 Identity:87/243 - (35%)
Similarity:124/243 - (51%) Gaps:24/243 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly  1248 EKEDMEHLQAY---NRK---LLENILPVHVAEHFLSREKHLDDLYHEQCDSVCILFASIPNFSEF 1306
            ||...|..|||   .||   ||..|||..|||..    |..:.:..|..|||.|.|:.|..|:  
Human   869 EKLVEERTQAYLEEKRKAEALLYQILPHSVAEQL----KRGETVQAEAFDSVTIYFSDIVGFT-- 927

  Fly  1307 YVELEGNNEGVECLRLLNEIIADFDELLSEERFRCIEKIKSTGATYMAASGLTANTCDRVNFSHV 1371
              .|...:..::.:.|||::...||.::  :.|. :.|:::.|..||..|||......|    |.
Human   928 --ALSAESTPMQVVTLLNDLYTCFDAII--DNFD-VYKVETIGDAYMVVSGLPGRNGQR----HA 983

  Fly  1372 TAMADYALQLFDKIE--EVNMHSFNNFRMRIGINIGPVVAGVIGACKPQYDIWGNAVNVASRMDS 1434
            ..:|..||.|.|.:.  .:.....:..|:|||::.|||.|||:|...|:|.::|:.||.||||:|
Human   984 PEIARMALALLDAVSSFRIRHRPHDQLRLRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRMES 1048

  Fly  1435 TGLVDHIQVTQEMQQILEGRG-FELTCRGSVDVKGKGSMITYFLKGRR 1481
            .|....|.|:...:..|:..| |:|..||.|::||||.|.||:|.|.|
Human  1049 NGQALKIHVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTYWLLGER 1096

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43373NP_001097622.2 AC_N <523..720 CDD:292831
CYCc 686..881 CDD:214485
Guanylate_cyc 722..895 CDD:278633
DUF1053 <949..1005 CDD:283888
CYCc 1259..1455 CDD:214485 65/200 (33%)
Guanylate_cyc 1285..1479 CDD:278633 68/196 (35%)
NPR2XP_024303324.1 Periplasmic_Binding_Protein_Type_1 26..421 CDD:324556
PK_GC-A_B 521..848 CDD:270944
HNOBA <857..902 CDD:311573 16/32 (50%)
CYCc 881..1065 CDD:214485 64/198 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.