DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43373 and Gycalpha99B

DIOPT Version :9

Sequence 1:NP_001097622.2 Gene:CG43373 / 39835 FlyBaseID:FBgn0263131 Length:1854 Species:Drosophila melanogaster
Sequence 2:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster


Alignment Length:210 Identity:61/210 - (29%)
Similarity:102/210 - (48%) Gaps:14/210 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   678 EARLRTQRENQQQERLLLSVLPRHVAMEMKDDIAGQPRDTQFHKIYIQRHENVSILFADICGFTS 742
            ||.....:|.::...||..:.|..:|.::   ..|...|.       :.:.:|:|||:||.||||
  Fly   423 EANSAVTKERKKNVSLLHLIFPAEIAEKL---WLGSSIDA-------KTYPDVTILFSDIVGFTS 477

  Fly   743 LSDQCTAEELVRLLNELFARFDRLAAEHHCLRIKLLGDCYYCVSGLPEPRPDHAHCAVEMGLDMI 807
            :..:.|...::.:|..|:..||.........:::.:||.|...|||.......||....|.|.||
  Fly   478 ICSRATPFMVISMLEGLYKDFDEFCDFFDVYKVETIGDAYCVASGLHRASIYDAHKVAWMALKMI 542

  Fly   808 DAIALVREVMAVNVNMRVGIHTGRVHCGVLGLVKWQFDVWSNDVTLANHMESGGIPGRVHI---T 869
            ||.:.........:.||:|:|||.|..||:|....::.::.:.||:||..|||....::::   |
  Fly   543 DACSKHITHDGEQIKMRIGLHTGTVLAGVVGRKMPRYCLFGHSVTIANKFESGSEALKINVSPTT 607

  Fly   870 KETLKCLDGDYEVEV 884
            |:.|...:| :|.|:
  Fly   608 KDWLTKHEG-FEFEL 621

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43373NP_001097622.2 AC_N <523..720 CDD:292831 9/41 (22%)
CYCc 686..881 CDD:214485 57/197 (29%)
Guanylate_cyc 722..895 CDD:278633 52/166 (31%)
DUF1053 <949..1005 CDD:283888
CYCc 1259..1455 CDD:214485
Guanylate_cyc 1285..1479 CDD:278633
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002
HNOBA 259..451 CDD:285003 7/27 (26%)
CYCc 430..619 CDD:214485 57/199 (29%)
Guanylate_cyc 457..647 CDD:278633 53/173 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453947
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.