DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43373 and Gyc89Da

DIOPT Version :9

Sequence 1:NP_001097622.2 Gene:CG43373 / 39835 FlyBaseID:FBgn0263131 Length:1854 Species:Drosophila melanogaster
Sequence 2:NP_001036718.1 Gene:Gyc89Da / 42001 FlyBaseID:FBgn0038435 Length:667 Species:Drosophila melanogaster


Alignment Length:282 Identity:81/282 - (28%)
Similarity:136/282 - (48%) Gaps:40/282 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly  1203 NEEALLRYIIDSIFLFAFMLALIF-----HSHQTEATYRLDFIWKLQATEEKEDMEHLQAYNRKL 1262
            |...|.|.::.:.:.....|.::|     .|.:.|.:..|...||.|..|              |
  Fly   413 NPHGLSRELVMAGWQHCSKLEIMFEKEEQRSDELEKSLELADSWKRQGDE--------------L 463

  Fly  1263 LENILPVHVAEHFLSREKHLDDLYHEQCDSVCILFASIPN-FSEFYVELEGNNEGVECLRLLNEI 1326
            |.:::|..:||.....|:.:...:.|    |.::|..:.| :.|....::|   .::.:..||::
  Fly   464 LYSMIPRPIAERMRLSEEQVCQSFEE----VSVIFLEVMNVYDEGLNSIQG---AMQTVNTLNKV 521

  Fly  1327 IADFD-ELLSEERFRCIEKIKSTGATYMAASGLTANTCDRVNFSHVTAMADYALQLFDKIEEVNM 1390
            .:..| |::|.    .:.|:::.|..|||.||     ...||..|.....|.||::..|.:   .
  Fly   522 FSALDEEIISP----FVYKVETVGMVYMAVSG-----APDVNPLHAEHACDLALRVMKKFK---A 574

  Fly  1391 HSFNNFRMRIGINIGPVVAGVIGACKPQYDIWGNAVNVASRMDSTGLVDHIQVTQEMQQILEGRG 1455
            |...:..:|:|||.|||||||:|...|:|.::|:.||.||||:|:.....||:::.....:...|
  Fly   575 HDMGDVAIRVGINSGPVVAGVVGQKVPRYCLFGDTVNTASRMESSSDPWKIQLSKYTGDKVRQVG 639

  Fly  1456 FELTCRGSVDVKGKGSMITYFL 1477
            :::..||:|.|||||.|.||:|
  Fly   640 YKVESRGTVQVKGKGDMETYWL 661

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43373NP_001097622.2 AC_N <523..720 CDD:292831
CYCc 686..881 CDD:214485
Guanylate_cyc 722..895 CDD:278633
DUF1053 <949..1005 CDD:283888
CYCc 1259..1455 CDD:214485 56/197 (28%)
Guanylate_cyc 1285..1479 CDD:278633 63/195 (32%)
Gyc89DaNP_001036718.1 HNOB 2..161 CDD:285002
HNOBA 218..476 CDD:285003 17/76 (22%)
CYCc 457..643 CDD:214485 60/218 (28%)
Guanylate_cyc 485..662 CDD:278633 63/196 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453949
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.