DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43373 and GUCY1B1

DIOPT Version :9

Sequence 1:NP_001097622.2 Gene:CG43373 / 39835 FlyBaseID:FBgn0263131 Length:1854 Species:Drosophila melanogaster
Sequence 2:XP_011530203.1 Gene:GUCY1B1 / 2983 HGNCID:4687 Length:662 Species:Homo sapiens


Alignment Length:589 Identity:132/589 - (22%)
Similarity:218/589 - (37%) Gaps:219/589 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   416 EKRSLQD--AGLVKGGGIQ--------------------TQLIVDTATDDDADVYTVASDDDDDV 458
            |:..|||  .|::|....|                    ||.:::.....:.|.|       :|:
Human   138 EREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQRNEECDHTQFLIEEKESKEEDFY-------EDL 195

  Fly   459 DGGRSAGSKHITYTPRVRDYNQISHAERDEVLNTSSNAGVATDNSDPPLGYGQLIPL-ILMQVDE 522
            |.....|::.          ::||                       |..:.:..|. |:...| 
Human   196 DRFEENGTQE----------SRIS-----------------------PYTFCKAFPFHIIFDRD- 226

  Fly   523 SVLVFLIVMLICGIVYAFLLCILSKPAMNEIFLVLV-----SYVILGTFLAIEVAVSYAMQPSKS 582
                  :|:..||               |.|:.||.     :..:|..|..:...:..      |
Human   227 ------LVVTQCG---------------NAIYRVLPQLQPGNCSLLSVFSLVRPHIDI------S 264

  Fly   583 FNGSACCIVLIYMTYTMLPLRLREALIGGILLSVVHL----------YTCLRLNAMQDEAVEMIH 637
            |:|     :|.::. |:..||.:|.     ||.|..|          .:||||..      :||:
Human   265 FHG-----ILSHIN-TVFVLRSKEG-----LLDVEKLECEDELTGTEISCLRLKG------QMIY 312

  Fly   638 WEE-----LLCTLVALLLANLT--GVY-THWPKEKAQRKAFI-------ETRQCIEARLRTQR-- 685
            ..|     .||:...:.|.:||  |:| :..|...|.|...:       |.:...|..:.|.|  
Human   313 LPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQ 377

  Fly   686 ------ENQQQE---------------------------------------------RLLLSVLP 699
                  |:::::                                             |||.||||
Human   378 LTLRALEDEKKKTDTGCPARIQAFKVQTTLMLCEKDSRSTKGFPSISYSGFLLIPLNRLLYSVLP 442

  Fly   700 RHVAMEMKDDIAGQPRDTQFHK--IYIQRHENVSILFADICGFTSLSDQCTAEE----LVRLLNE 758
            ..||.|::            ||  :..:|::||:|||:.|.||.:...:..:.|    :|.|||:
Human   443 PSVANELR------------HKRPVPAKRYDNVTILFSGIVGFNAFCSKHASGEGAMKIVNLLND 495

  Fly   759 LFARFDRLAAEH---HCLRIKLLGDCYYCVSGLPEPRPDHAHCAVEMGLDMIDAIALVREVMAVN 820
            |:.|||.|....   ...:::.:||.|..|||||||...||.....:.|||::....| :|...:
Human   496 LYTRFDTLTDSRKNPFVYKVETVGDKYMTVSGLPEPCIHHARSICHLALDMMEIAGQV-QVDGES 559

  Fly   821 VNMRVGIHTGRVHCGVLGLVKWQFDVWSNDVTLANHMESGGIPGRVHITKETLKCL------DGD 879
            |.:.:|||||.|..||:|....::.::.|.|.|.:..|:.|..|::::::.|.:||      |..
Human   560 VQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQ 624

  Fly   880 YEVE 883
            :.:|
Human   625 FHLE 628

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43373NP_001097622.2 AC_N <523..720 CDD:292831 53/279 (19%)
CYCc 686..881 CDD:214485 69/254 (27%)
Guanylate_cyc 722..895 CDD:278633 57/175 (33%)
DUF1053 <949..1005 CDD:283888
CYCc 1259..1455 CDD:214485
Guanylate_cyc 1285..1479 CDD:278633
GUCY1B1XP_011530203.1 HNOB 2..166 CDD:311572 7/27 (26%)
HNOBA 207..449 CDD:311573 58/309 (19%)
Guanylate_cyc 455..648 CDD:306677 57/175 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.