DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43373 and GUCY1A2

DIOPT Version :9

Sequence 1:NP_001097622.2 Gene:CG43373 / 39835 FlyBaseID:FBgn0263131 Length:1854 Species:Drosophila melanogaster
Sequence 2:NP_001243353.1 Gene:GUCY1A2 / 2977 HGNCID:4684 Length:763 Species:Homo sapiens


Alignment Length:309 Identity:78/309 - (25%)
Similarity:135/309 - (43%) Gaps:94/309 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   662 KEKAQRKAFIE-TRQCIEARLRTQRENQQQERLLLSVLPRHVAMEMKDDIAGQPRDTQFHKIYIQ 725
            |...:.||.:| |.|.:|      .|.::...||.|:.|..||.::          .|..::..:
Human   467 KRMDKLKATLERTHQALE------EEKKKTVDLLYSIFPGDVAQQL----------WQGQQVQAR 515

  Fly   726 RHENVSILFADICGFTSLSDQCTAEELVRLLNELFARFDRLAAEHHC-----LRIKLLGDCYYCV 785
            :.::|::||:||.|||::..|||..:::.:||||:.|||     |.|     .:::.:||.|...
Human   516 KFDDVTMLFSDIVGFTAICAQCTPMQVISMLNELYTRFD-----HQCGFLDIYKVETIGDAYCVA 575

  Fly   786 SGLPEPRPDHAHCAVEMGLDMIDAIALVREVMA------------------VNV----------- 821
            :||......||.....|.|.|::   |..||:.                  |::           
Human   576 AGLHRKSLCHAKPIALMALKMME---LSEEVLTPDGRPIQPQRSELLFSFPVSIQLVPDQHQSET 637

  Fly   822 -----NMRVGIHTGRVHCGVLGLVKWQFDVWSNDVTLANHMESGGIPGRVHITKETLKCLDGDYE 881
                 .||:|||:|.|..||:|:...::.::.|:||||:..|||..|.|::::..|.:.|..:  
Human   638 DLGTEKMRIGIHSGSVLAGVVGVRMPRYCLFGNNVTLASKFESGSHPRRINVSPTTYQLLKRE-- 700

  Fly   882 VEVGKGNERNSYLKDHQIETYLIVPGDIYRPHKKSRNRLQVNGNISKEL 930
                              |::..:|          |:|.::..|..||:
Human   701 ------------------ESFTFIP----------RSREELPDNFPKEI 721

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43373NP_001097622.2 AC_N <523..720 CDD:292831 15/58 (26%)
CYCc 686..881 CDD:214485 64/233 (27%)
Guanylate_cyc 722..895 CDD:278633 56/211 (27%)
DUF1053 <949..1005 CDD:283888
CYCc 1259..1455 CDD:214485
Guanylate_cyc 1285..1479 CDD:278633
GUCY1A2NP_001243353.1 HNOB <159..270 CDD:285002
HNOBA 316..503 CDD:285003 12/41 (29%)
CYCc 485..705 CDD:214485 65/257 (25%)
Guanylate_cyc 514..729 CDD:278633 63/246 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.