DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43373 and Gucy2c

DIOPT Version :9

Sequence 1:NP_001097622.2 Gene:CG43373 / 39835 FlyBaseID:FBgn0263131 Length:1854 Species:Drosophila melanogaster
Sequence 2:NP_037302.1 Gene:Gucy2c / 25711 RGDID:2771 Length:1072 Species:Rattus norvegicus


Alignment Length:295 Identity:81/295 - (27%)
Similarity:142/295 - (48%) Gaps:39/295 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   650 LANLTGVYTHWPKEKAQRKAFIETRQCIEARL------RTQ---RENQQQERLLLSVLPRHVAME 705
            ||.:.|:: |..|.::.....|...|.....|      |||   .|..:.:.|...:|||.|...
  Rat   744 LAKIFGLF-HDQKNESYMDTLIRRLQLYSRNLEHLVEERTQLYKAERDRADHLNFMLLPRLVVKS 807

  Fly   706 MKDDIAGQPRDTQFHKIYIQRHENVSILFADICGFTSLSDQCTAEELVRLLNELFARFDRLAAEH 770
            :|:....:|          :.:|.|:|.|:||.|||::....|..|:|.:||:::..||::...|
  Rat   808 LKEKGIVEP----------ELYEEVTIYFSDIVGFTTICKYSTPMEVVDMLNDIYKSFDQIVDHH 862

  Fly   771 HCLRIKLLGDCYYCVSGLPEPRPD-HAHCAVEMGLDMIDAIAL--VREVMAVNVNMRVGIHTGRV 832
            ...:::.:||.|...||||....: ||....:|.||::..:..  :..:..:.|.:|:|:|:|..
  Rat   863 DVYKVETIGDAYVVASGLPMRNGNRHAVDISKMALDILSFMGTFELEHLPGLPVWIRIGVHSGPC 927

  Fly   833 HCGVLGLVKWQFDVWSNDVTLANHMESGGIPGRVHITKETLKCL---DGDYEVEV-------GKG 887
            ..||:|:...::.::.:.|..|:.|||.|:|.|:|::..|:..|   |..:..||       |:|
  Rat   928 AAGVVGIKMPRYCLFGDTVNTASRMESTGLPLRIHMSSSTIAILRRTDCQFLYEVRGETYLKGRG 992

  Fly   888 NERNSYLKDHQIETY-LIVPGDIYRPHKKSRNRLQ 921
            .|...:|...:.:.| |..|     |..:::.|||
  Rat   993 TETTYWLTGMKDQEYNLPTP-----PTVENQQRLQ 1022

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43373NP_001097622.2 AC_N <523..720 CDD:292831 19/78 (24%)
CYCc 686..881 CDD:214485 57/200 (29%)
Guanylate_cyc 722..895 CDD:278633 54/185 (29%)
DUF1053 <949..1005 CDD:283888
CYCc 1259..1455 CDD:214485
Guanylate_cyc 1285..1479 CDD:278633
Gucy2cNP_037302.1 Periplasmic_Binding_Protein_Type_1 34..414 CDD:299141
PKc_like 479..749 CDD:304357 2/4 (50%)
STYKc 501..744 CDD:214568 81/295 (27%)
CYCc 787..978 CDD:214485 57/200 (29%)
Guanylate_cyc 814..1001 CDD:278633 56/196 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.