DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43373 and gcy-21

DIOPT Version :9

Sequence 1:NP_001097622.2 Gene:CG43373 / 39835 FlyBaseID:FBgn0263131 Length:1854 Species:Drosophila melanogaster
Sequence 2:NP_001364740.1 Gene:gcy-21 / 191651 WormBaseID:WBGene00001546 Length:1163 Species:Caenorhabditis elegans


Alignment Length:236 Identity:74/236 - (31%)
Similarity:128/236 - (54%) Gaps:18/236 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly  1247 EEKEDMEHLQAYNRKLLENILPVHVAEHFLSREKHLDDLYHEQCDSVCILFASIPNFSEFYVELE 1311
            |..|::|..:|.:..||:.:||..||:..    |...::..|..::..:.|:..|.|    ||:.
 Worm   910 ERNEELEGEKAKSEALLKMMLPEVVADSL----KLGSNVSAESFENCTVFFSDCPGF----VEMS 966

  Fly  1312 GNNEGVECLRLLNEIIADFDELLSEERFRCIEKIKSTGATYMAASGLTANTCDRVNFSHVTAMAD 1376
            ..::.::.::.||::...||.::  ::|. :.|:::....||.||||.....:.    |...:|.
 Worm   967 ATSKPIDIVQFLNDLYTVFDRII--DQFD-VYKVETIADAYMVASGLPVPNGNH----HAGEIAS 1024

  Fly  1377 YALQLFDKIEEVNMHSFNN--FRMRIGINIGPVVAGVIGACKPQYDIWGNAVNVASRMDSTGLVD 1439
            ..|.|...:|...:....|  .|:|||:|.||.||||:|...|:|.::|:.||.||||:|.|:..
 Worm  1025 LGLALLKAVESFKIRHLPNEKVRLRIGMNSGPCVAGVVGLKMPRYCLFGDTVNTASRMESNGIPL 1089

  Fly  1440 HIQVTQEMQQILEG-RGFELTCRGSVDVKGKGSMITYFLKG 1479
            .|..:...::||:. .|:|:..||.|::||||..:|||::|
 Worm  1090 RINCSGTAKEILDQLGGYEIEERGIVEMKGKGKQMTYFVRG 1130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43373NP_001097622.2 AC_N <523..720 CDD:292831
CYCc 686..881 CDD:214485
Guanylate_cyc 722..895 CDD:278633
DUF1053 <949..1005 CDD:283888
CYCc 1259..1455 CDD:214485 57/198 (29%)
Guanylate_cyc 1285..1479 CDD:278633 62/196 (32%)
gcy-21NP_001364740.1 Periplasmic_Binding_Protein_type1 58..422 CDD:415822
PK_GC 612..881 CDD:270894
HNOBA <890..938 CDD:400168 10/27 (37%)
Guanylate_cyc 944..1130 CDD:306677 62/196 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.