DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43373 and gcy-15

DIOPT Version :10

Sequence 1:NP_001097622.2 Gene:CG43373 / 39835 FlyBaseID:FBgn0263131 Length:1854 Species:Drosophila melanogaster
Sequence 2:NP_001364713.1 Gene:gcy-15 / 191648 WormBaseID:WBGene00001541 Length:1104 Species:Caenorhabditis elegans


Alignment Length:236 Identity:74/236 - (31%)
Similarity:128/236 - (54%) Gaps:18/236 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly  1247 EEKEDMEHLQAYNRKLLENILPVHVAEHFLSREKHLDDLYHEQCDSVCILFASIPNFSEFYVELE 1311
            |..|::|..:|.:..||:.:||..||:..    |...::..|..::..:.|:..|.|    ||:.
 Worm   851 ERNEELEAEKAKSEALLKMMLPEVVADSL----KLGSNVSAESFENCTVFFSDCPGF----VEMS 907

  Fly  1312 GNNEGVECLRLLNEIIADFDELLSEERFRCIEKIKSTGATYMAASGLTANTCDRVNFSHVTAMAD 1376
            ..::.::.::.||::...||.::  ::|. :.|:::....||.||||.....:.    |...:|.
 Worm   908 ATSKPIDIVQFLNDLYTVFDRII--DQFD-VYKVETIADAYMVASGLPVPNGNH----HAGEIAS 965

  Fly  1377 YALQLFDKIEEVNMHSFNN--FRMRIGINIGPVVAGVIGACKPQYDIWGNAVNVASRMDSTGLVD 1439
            ..|.|...:|...:....|  .|:|||:|.||.||||:|...|:|.::|:.||.||||:|.|:..
 Worm   966 LGLALLKAVESFKIRHLPNEKVRLRIGMNSGPCVAGVVGLKMPRYCLFGDTVNTASRMESNGIPL 1030

  Fly  1440 HIQVTQEMQQILEG-RGFELTCRGSVDVKGKGSMITYFLKG 1479
            .|..:...::||:. .|:|:..||.|::||||..:|||::|
 Worm  1031 RINCSGTAKEILDQLGGYEIEERGIVEMKGKGKQMTYFVRG 1071

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43373NP_001097622.2 AC_N <523..720 CDD:318454
Guanylate_cyc 722..904 CDD:425528
Adcy_cons_dom <949..1005 CDD:461877
Guanylate_cyc 1285..1479 CDD:425528 62/196 (32%)
gcy-15NP_001364713.1 Periplasmic_Binding_Protein_type1 2..363 CDD:471960
PK_GC 553..822 CDD:270894
HNOBA <831..879 CDD:462234 10/27 (37%)
Guanylate_cyc 885..1071 CDD:425528 62/196 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.