Sequence 1: | NP_001097622.2 | Gene: | CG43373 / 39835 | FlyBaseID: | FBgn0263131 | Length: | 1854 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_506097.3 | Gene: | gcy-13 / 191646 | WormBaseID: | WBGene00001539 | Length: | 1028 | Species: | Caenorhabditis elegans |
Alignment Length: | 215 | Identity: | 63/215 - (29%) |
---|---|---|---|
Similarity: | 114/215 - (53%) | Gaps: | 23/215 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 686 ENQQQERLLLSVLPRHVAMEMKDDIAGQPRDTQFHKIYIQRHENVSILFADICGFTSLSDQCTAE 750
Fly 751 ELVRLLNELFARFDRLAAEHHCLRIKLLGDCYYCVSGLPEPR-PDHAHCAVEMGLDMIDAIAL-- 812
Fly 813 VREVMAVNVNMRVGIHTGRVHCGVLGLVKWQFDVWSNDVTLANHMESGGIPGRVHITK---ETLK 874
Fly 875 CLDGDYEVE-------VGKG 887 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG43373 | NP_001097622.2 | AC_N | <523..720 | CDD:292831 | 9/33 (27%) |
CYCc | 686..881 | CDD:214485 | 58/200 (29%) | ||
Guanylate_cyc | 722..895 | CDD:278633 | 54/179 (30%) | ||
DUF1053 | <949..1005 | CDD:283888 | |||
CYCc | 1259..1455 | CDD:214485 | |||
Guanylate_cyc | 1285..1479 | CDD:278633 | |||
gcy-13 | NP_506097.3 | PBP1_NPR_GC_like | 3..397 | CDD:107347 | |
ANF_receptor | 13..368 | CDD:279440 | |||
PKc_like | 548..770 | CDD:304357 | |||
HNOBA | <797..829 | CDD:285003 | 7/19 (37%) | ||
CYCc | 808..1000 | CDD:214485 | 58/200 (29%) | ||
Guanylate_cyc | 835..1022 | CDD:278633 | 55/189 (29%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2114 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |