DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43373 and gcy-13

DIOPT Version :9

Sequence 1:NP_001097622.2 Gene:CG43373 / 39835 FlyBaseID:FBgn0263131 Length:1854 Species:Drosophila melanogaster
Sequence 2:NP_506097.3 Gene:gcy-13 / 191646 WormBaseID:WBGene00001539 Length:1028 Species:Caenorhabditis elegans


Alignment Length:215 Identity:63/215 - (29%)
Similarity:114/215 - (53%) Gaps:23/215 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   686 ENQQQERLLLSVLPRHVAMEMKDDIAGQPRDTQFHKIYIQRHENVSILFADICGFTSLSDQCTAE 750
            |.::.:.||..:||:.||..:|...:.:|          :..|:|:|.|:|:.|||.|:::.|..
 Worm   809 EKKKSDILLYRMLPQQVAERLKLGQSVEP----------EAFESVTIFFSDVVGFTVLANKSTPL 863

  Fly   751 ELVRLLNELFARFDRLAAEHHCLRIKLLGDCYYCVSGLPEPR-PDHAHCAVEMGLDMIDAIAL-- 812
            ::|.|||:|:..||.:..::...:::.:||.|..|||||... .:|......|.|:::|::..  
 Worm   864 QVVNLLNDLYTTFDAIIEKNDSYKVETIGDAYLVVSGLPRRNGTEHVANIANMSLELMDSLQAFK 928

  Fly   813 VREVMAVNVNMRVGIHTGRVHCGVLGLVKWQFDVWSNDVTLANHMESGGIPGRVHITK---ETLK 874
            :..:....|.:|:|:|:|....||:||...::.::.:.|..|:.|||.|.||.:|::.   :.|.
 Worm   929 IPHLPQEKVQIRIGMHSGSCVAGVVGLTMPRYCLFGDTVNTASRMESNGKPGFIHLSSDCYDLLT 993

  Fly   875 CLDGDYEVE-------VGKG 887
            .|..:|..|       .|||
 Worm   994 SLYKEYNTESRGEVIIKGKG 1013

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43373NP_001097622.2 AC_N <523..720 CDD:292831 9/33 (27%)
CYCc 686..881 CDD:214485 58/200 (29%)
Guanylate_cyc 722..895 CDD:278633 54/179 (30%)
DUF1053 <949..1005 CDD:283888
CYCc 1259..1455 CDD:214485
Guanylate_cyc 1285..1479 CDD:278633
gcy-13NP_506097.3 PBP1_NPR_GC_like 3..397 CDD:107347
ANF_receptor 13..368 CDD:279440
PKc_like 548..770 CDD:304357
HNOBA <797..829 CDD:285003 7/19 (37%)
CYCc 808..1000 CDD:214485 58/200 (29%)
Guanylate_cyc 835..1022 CDD:278633 55/189 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.