DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43373 and gcy-11

DIOPT Version :9

Sequence 1:NP_001097622.2 Gene:CG43373 / 39835 FlyBaseID:FBgn0263131 Length:1854 Species:Drosophila melanogaster
Sequence 2:NP_001359843.1 Gene:gcy-11 / 181745 WormBaseID:WBGene00001537 Length:1168 Species:Caenorhabditis elegans


Alignment Length:361 Identity:98/361 - (27%)
Similarity:164/361 - (45%) Gaps:87/361 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   591 VLIYMTYTMLPLRLREALIGGILLSVVHLYTCLRLNAMQDEAVEMIHWEE---------LLCTLV 646
            :::|..|.      |:...|..||.             .||.:|.:.:.:         .|.|..
 Worm   810 IVLYEIYG------RQGPFGDDLLD-------------SDEIIEQLKFPDGGALTRPDIHLITKA 855

  Fly   647 ALLLANLTGVYTHWPKEKAQRKAFIETRQCIE----------------------------ARLRT 683
            ...||::  |...|.::.|.|.:..:.|:.::                            .:.||
 Worm   856 PYPLASV--VEKCWVEDPASRPSIKKVRELLKPLSKGLKGNIADNIMNLLDRYRNNLEDVIKERT 918

  Fly   684 QR---ENQQQERLLLSVLPRHVAMEMKDDIAGQPRDTQFHKIYIQRHENVSILFADICGFTSLSD 745
            ::   |.::.|.|||.:||:.||..:|:   |||.|.:|       :::|||.|:||.|||:||.
 Worm   919 EQLEDERKRNESLLLQLLPKSVANSLKN---GQPVDAEF-------YDSVSIYFSDIVGFTALSS 973

  Fly   746 QCTAEELVRLLNELFARFDRLAAEHHCLRIKLLGDCYYCVSGLPEPRPD-HAHCAVEMGLDMIDA 809
            :.|..::|.:||.|:..||.:..:..|.:::.:||.|..||||||.... ||.......|:::|:
 Worm   974 KSTPLQVVNMLNNLYTNFDTIIDKFDCYKVETIGDAYMFVSGLPEVNSYLHAGEVASASLELLDS 1038

  Fly   810 IA--LVREVMAVNVNMRVGIHTGRVHCGVLGLVKWQFDVWSNDVTLANHMESGGIPGRVHITKET 872
            |.  .|.......:.:|:|.|||.|..||:|:...::.::.:.|.:||.|||.|.|.|:.|:.:.
 Worm  1039 IKTFTVSHCPDEKLRLRIGNHTGPVVTGVVGIRMPRYCLFGDTVIIANMMESSGEPMRIQISSDA 1103

  Fly   873 ----LKCLDGDYEVEVGKGNERNSYLKDHQIE--TY 902
                |||  |.|..|     :|...:..:::|  ||
 Worm  1104 YELILKC--GGYVTE-----QREKIVLKNKLEVMTY 1132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43373NP_001097622.2 AC_N <523..720 CDD:292831 34/168 (20%)
CYCc 686..881 CDD:214485 72/201 (36%)
Guanylate_cyc 722..895 CDD:278633 60/179 (34%)
DUF1053 <949..1005 CDD:283888
CYCc 1259..1455 CDD:214485
Guanylate_cyc 1285..1479 CDD:278633
gcy-11NP_001359843.1 Periplasmic_Binding_Protein_type1 <234..452 CDD:385651
PKc_like 640..890 CDD:389743 18/100 (18%)
CYCc 923..1116 CDD:214485 73/204 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.