DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43373 and gcy-22

DIOPT Version :9

Sequence 1:NP_001097622.2 Gene:CG43373 / 39835 FlyBaseID:FBgn0263131 Length:1854 Species:Drosophila melanogaster
Sequence 2:NP_508018.2 Gene:gcy-22 / 180365 WormBaseID:WBGene00001547 Length:1058 Species:Caenorhabditis elegans


Alignment Length:239 Identity:79/239 - (33%)
Similarity:131/239 - (54%) Gaps:25/239 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   677 IEARLR-TQRENQQQERLLLSVLPRHVAMEMKDDIAGQPRDTQFHKIYIQRHENVSILFADICGF 740
            ::||:: ...|.::.:.||..:||:.||.::|...:.:|          :..:.|:|.|:|:..|
 Worm   822 VQARMKELTEEKKRSDVLLYRMLPKQVAEKLKLGQSVEP----------ETFDCVTIFFSDVVSF 876

  Fly   741 TSLSDQCTAEELVRLLNELFARFDRLAAEHHCLRIKLLGDCYYCVSGLPEPR-PDHAHCAVEMGL 804
            |:|:.:||..::|.|||:|:..||.:..:|...:::.:||.|.||||||... .:||.....|..
 Worm   877 TTLASRCTPLQVVNLLNDLYTTFDAIIEQHDVYKVETIGDGYLCVSGLPHRNGNEHAKEISSMSF 941

  Fly   805 DMIDAIALVR--EVMAVNVNMRVGIHTGRVHCGVLGLVKWQFDVWSNDVTLANHMESGGIPGRVH 867
            .::.||...|  .:....:|:|||:|||.|..||:|:...::.::.:.|..|:.|||.|.|||||
 Worm   942 SLLKAIKTFRVPHLPKERINIRVGLHTGPVVTGVVGMTMPRYCLFGDSVNTASRMESNGKPGRVH 1006

  Fly   868 ITKETLKCLD---GDYEVE-------VGKGNERNSY-LKDHQIE 900
            |:.|.:|.|.   |.|:.|       .|||..:..: |.|.:||
 Worm  1007 ISTECMKFLTEVIGGYQTEPRGEVIVKGKGAVQTHWLLTDDEIE 1050

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43373NP_001097622.2 AC_N <523..720 CDD:292831 11/43 (26%)
CYCc 686..881 CDD:214485 68/200 (34%)
Guanylate_cyc 722..895 CDD:278633 64/186 (34%)
DUF1053 <949..1005 CDD:283888
CYCc 1259..1455 CDD:214485
Guanylate_cyc 1285..1479 CDD:278633
gcy-22NP_508018.2 Periplasmic_Binding_Protein_Type_1 28..408 CDD:299141
ANF_receptor 48..399 CDD:279440
PKc_like 553..795 CDD:304357
HNOBA <791..852 CDD:285003 9/29 (31%)
CYCc 831..1023 CDD:214485 68/201 (34%)
Guanylate_cyc 858..1044 CDD:278633 65/195 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.