DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43373 and gcy-29

DIOPT Version :9

Sequence 1:NP_001097622.2 Gene:CG43373 / 39835 FlyBaseID:FBgn0263131 Length:1854 Species:Drosophila melanogaster
Sequence 2:NP_001364597.1 Gene:gcy-29 / 175116 WormBaseID:WBGene00007314 Length:1069 Species:Caenorhabditis elegans


Alignment Length:259 Identity:79/259 - (30%)
Similarity:132/259 - (50%) Gaps:42/259 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   673 TRQCIEARLRTQRENQQQERLLLSVLPRHVAMEMKDDIAGQPRDTQFHKIYIQRHENVSILFADI 737
            |:...||.||.       ||||..:||:|||:|:|   ||:   |...|:|    ::.:::|:||
 Worm   835 TKLAEEANLRA-------ERLLFQLLPKHVAIELK---AGR---TVAPKMY----DSATVMFSDI 882

  Fly   738 CGFTSLSDQCTAEELVRLLNELFARFDRLAAEHHCLRIKLLGDCYYCVSGLPEPRPDHAHCAVEM 802
            .|||.|....|..|:|.|||:|::.||.:.::|.|.:::.:||.|..|||:|          :|.
 Worm   883 VGFTKLCSASTPIEVVNLLNKLYSEFDTVISKHDCYKVETIGDAYMVVSGIP----------IEN 937

  Fly   803 G---LDMIDAIAL-VREVMAV---------NVNMRVGIHTGRVHCGVLGLVKWQFDVWSNDVTLA 854
            |   :..|.|:.| :.:::.|         .:.:|:|..:|:|...|:||...::.::...|.:|
 Worm   938 GQRHVANISAVTLGIMDLLKVFEVPHRRDYRLTIRLGFASGQVSAAVVGLSSPRYCLFGETVNIA 1002

  Fly   855 NHMESGGIPGRVHITKETLKCLDGDYEVEVGKGNERNSYLKDHQIETYLIVPGDIYRPHKKSRN 918
            ..|||.|..|||.||:.:...|:.:|...:.:....|..:|.....||.:...|  ..:.|.:|
 Worm  1003 AVMESSGEGGRVQITETSKILLENEYPEFIIEIRGINKDVKQDDFVTYWLTGKD--EDYFKKKN 1064

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43373NP_001097622.2 AC_N <523..720 CDD:292831 19/46 (41%)
CYCc 686..881 CDD:214485 66/207 (32%)
Guanylate_cyc 722..895 CDD:278633 53/185 (29%)
DUF1053 <949..1005 CDD:283888
CYCc 1259..1455 CDD:214485
Guanylate_cyc 1285..1479 CDD:278633
gcy-29NP_001364597.1 PBP1_NPR_GC-like 27..403 CDD:380575
PKc_like 534..804 CDD:419665
CYCc 840..1033 CDD:214485 71/219 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.