DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43373 and gucy2f

DIOPT Version :9

Sequence 1:NP_001097622.2 Gene:CG43373 / 39835 FlyBaseID:FBgn0263131 Length:1854 Species:Drosophila melanogaster
Sequence 2:NP_571939.2 Gene:gucy2f / 140424 ZFINID:ZDB-GENE-011128-7 Length:1107 Species:Danio rerio


Alignment Length:261 Identity:80/261 - (30%)
Similarity:131/261 - (50%) Gaps:52/261 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   680 RLRTQR---ENQQQERLLLSVLPRHVAMEMKDDIAGQPRDTQFHKIYIQRHENVSILFADICGFT 741
            |.||:.   |.|:.|:||..:||..||..:|...:.:|          :..:.|:|.|:||.|||
Zfish   841 RERTEELEVEKQRTEKLLSEMLPPSVAEALKTGASVEP----------EYFDQVTIYFSDIVGFT 895

  Fly   742 SLSDQCTAEELVRLLNELFARFDRLAAEHHCLRIKLLGDCYYCVSGLPEPRPD-HAHCAVEMGLD 805
            ::|......|:|.|||:|::.||.:...|...:::.:||.|...||||:...: ||.....|.|:
Zfish   896 TISSLSDPIEVVDLLNDLYSLFDAVLGSHDVYKVETIGDAYMVASGLPKKNGNKHAAEIANMSLN 960

  Fly   806 MIDAIA--LVREVMAVNVNMRVGIHTGRVHCGVLGLVKWQFDVWSNDVTLANHMESGGIPGRVHI 868
            ::.::.  .:|.:..|.|.:|:|||:|....||:||...::.::.:.|..|:.|||.|:|.|:|:
Zfish   961 ILSSVGSFKMRHMPEVPVRIRIGIHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHV 1025

  Fly   869 ---TKETLKCLDGDYEVEV-------GKGNERNSYLKDHQIETYLIV----------------PG 907
               |.:.|:.|:..|:::|       |||.|          |||.:|                ||
Zfish  1026 NISTVQILRSLNDGYKIDVRGKTELKGKGIE----------ETYWLVGKANFTKPLPNPPEIKPG 1080

  Fly   908 D 908
            |
Zfish  1081 D 1081

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43373NP_001097622.2 AC_N <523..720 CDD:292831 14/42 (33%)
CYCc 686..881 CDD:214485 64/200 (32%)
Guanylate_cyc 722..895 CDD:278633 59/185 (32%)
DUF1053 <949..1005 CDD:283888
CYCc 1259..1455 CDD:214485
Guanylate_cyc 1285..1479 CDD:278633
gucy2fNP_571939.2 PBP1_sensory_GC_DEF_like 59..440 CDD:107366
PK_GC-2D 551..816 CDD:270945
HNOBA <825..870 CDD:311573 12/28 (43%)
CYCc 850..1042 CDD:214485 65/201 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.