DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43373 and Gucy2f

DIOPT Version :9

Sequence 1:NP_001097622.2 Gene:CG43373 / 39835 FlyBaseID:FBgn0263131 Length:1854 Species:Drosophila melanogaster
Sequence 2:NP_446283.1 Gene:Gucy2f / 116556 RGDID:620439 Length:1108 Species:Rattus norvegicus


Alignment Length:284 Identity:89/284 - (31%)
Similarity:140/284 - (49%) Gaps:47/284 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   680 RLRTQR---ENQQQERLLLSVLPRHVAMEMKDDIAGQPRDTQFHKIYIQRHENVSILFADICGFT 741
            |.||:.   |.|:.|:||..:||..||..:|.....:|          :..:.|::.|:||.|||
  Rat   840 RERTEELEIEKQKTEKLLTQMLPPSVAESLKKGCTVEP----------EGFDLVTLYFSDIVGFT 894

  Fly   742 SLSDQCTAEELVRLLNELFARFDRLAAEHHCLRIKLLGDCYYCVSGLPEPRPDHAHCA--VEMGL 804
            ::|......|:|.|||:|:..||.:...|...:::.:||.|...||||: |....|.|  ..|.|
  Rat   895 TISAMSEPIEVVDLLNDLYTLFDAIIGSHDVYKVETIGDAYMVASGLPK-RNGSRHAAEIANMSL 958

  Fly   805 DMIDAIAL--VREVMAVNVNMRVGIHTGRVHCGVLGLVKWQFDVWSNDVTLANHMESGGIPGRVH 867
            |::.::..  :|.:..|.|.:|:|:|||.|..||:||...::.::.:.|..|:.|||.|:|.|:|
  Rat   959 DILSSVGTFKMRHMPEVPVRIRIGLHTGPVVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIH 1023

  Fly   868 ITKET---LKCLDGDYEVEV-------GKGNERNSYLKDHQIETYLIVPGDIYRPHKKSRNR-LQ 921
            ::..|   |:.|...||||:       |||.|          ||:.:|       .||...: |.
  Rat  1024 VSLSTVTILRTLSEGYEVELRGRTELKGKGTE----------ETFWLV-------GKKGFTKPLP 1071

  Fly   922 VNGNISKELRMMGHGTAQKHTSKF 945
            |...:.|: ..:|||......:.|
  Rat  1072 VPPPVGKD-GQVGHGLQPAEIAAF 1094

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43373NP_001097622.2 AC_N <523..720 CDD:292831 14/42 (33%)
CYCc 686..881 CDD:214485 66/201 (33%)
Guanylate_cyc 722..895 CDD:278633 63/186 (34%)
DUF1053 <949..1005 CDD:283888
CYCc 1259..1455 CDD:214485
Guanylate_cyc 1285..1479 CDD:278633
Gucy2fNP_446283.1 PBP1_sensory_GC_DEF_like 54..435 CDD:107366
ANF_receptor 75..412 CDD:279440
PKc_like 545..815 CDD:304357
TyrKc 565..809 CDD:197581
HNOBA <824..869 CDD:285003 12/28 (43%)
CYCc 848..1040 CDD:214485 66/202 (33%)
Guanylate_cyc 875..1062 CDD:278633 67/214 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.