DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43373 and gucy1b1

DIOPT Version :9

Sequence 1:NP_001097622.2 Gene:CG43373 / 39835 FlyBaseID:FBgn0263131 Length:1854 Species:Drosophila melanogaster
Sequence 2:XP_004911214.1 Gene:gucy1b1 / 100379900 XenbaseID:XB-GENE-950986 Length:618 Species:Xenopus tropicalis


Alignment Length:533 Identity:128/533 - (24%)
Similarity:208/533 - (39%) Gaps:170/533 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   416 EKRSLQD--AGLVKGGGIQ--------------------TQLIVDTATDDDADVYTVASDDDDDV 458
            |:..|||  .|:||....|                    ||.:::.....:.|.|    :|.|..
 Frog   138 EREGLQDIVIGIVKTVAQQIHGTEIDMKVIQQRNEECDHTQFLIEEKDTREEDFY----EDQDRF 198

  Fly   459 DGGRSAGSKHITYTPRVRDYNQISHAERDEVLNTSSNAGVATDNSDPPLGYGQLIPLILMQVDES 523
            :...:..|:...||                                    :.:..|..:| .|..
 Frog   199 EENGTQESRISPYT------------------------------------FCKAFPFHIM-FDRD 226

  Fly   524 VLVFLIVMLICGIVYAFLLCILSKPAMNEIFLVLVSYV-----ILGTFLAIEVAVSYAMQPSKSF 583
            :.|     ..||               |.|:.||....     :|..|..:...:..      ||
 Frog   227 LFV-----TQCG---------------NAIYRVLPQLQPGNCNLLSVFSLVRPHIDI------SF 265

  Fly   584 NGSACCIVLIYMTYTMLPLRLREALIG-----------GILLSVVHLYTCLRLNAMQDEAVEMIH 637
            :|     :|.::. |:..||.:|.|:.           |..:|      ||||..      :||:
 Frog   266 HG-----ILSHIN-TVFVLRSKEGLLDVEKSESEDELTGTEIS------CLRLKG------QMIY 312

  Fly   638 WEE-----LLCTLVALLLANLT--GVY-THWPKEKAQRKAFI-------ETRQCIEARLRTQR-- 685
            ..|     .||:...:.|.:||  |:| :..|...|.|...:       |.:...|..:.|.|  
 Frog   313 LPEADNILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQ 377

  Fly   686 --------ENQQQERLLLSVLPRHVAMEMKDDIAGQPRDTQFHK--IYIQRHENVSILFADICGF 740
                    |.::.:.||.||||..||.|::            ||  :..:|::||:|||:.|.||
 Frog   378 HTLRALEDEKKKTDTLLYSVLPPSVANELR------------HKRPVPAKRYDNVTILFSGIVGF 430

  Fly   741 -TSLSDQCTAE---ELVRLLNELFARFDRLAAEH---HCLRIKLLGDCYYCVSGLPEPRPDHAHC 798
             |..|...:.|   ::|.|||:::.|||.|....   :..:::.:||.|..|||:|||...||..
 Frog   431 NTFCSKHASGEGAMKIVNLLNDIYTRFDILTDSRNNPYVYKVETVGDKYMTVSGIPEPCVHHARS 495

  Fly   799 AVEMGLDMIDAIALVREVMAVNVNMRVGIHTGRVHCGVLGLVKWQFDVWSNDVTLANHMESGGIP 863
            ...:.|||::....| :|...:|.:.:|||||.|..||:|....::.::.|.|.|.:..|:.|..
 Frog   496 ICHLALDMMEIAGQV-QVDGESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEK 559

  Fly   864 GRVHITKETLKCL 876
            |::::::.|.:||
 Frog   560 GKINVSEYTYRCL 572

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43373NP_001097622.2 AC_N <523..720 CDD:292831 51/237 (22%)
CYCc 686..881 CDD:214485 67/200 (34%)
Guanylate_cyc 722..895 CDD:278633 55/162 (34%)
DUF1053 <949..1005 CDD:283888
CYCc 1259..1455 CDD:214485
Guanylate_cyc 1285..1479 CDD:278633
gucy1b1XP_004911214.1 HNOB 2..166 CDD:377902 8/27 (30%)
HNOBA 207..406 CDD:369471 55/279 (20%)
Guanylate_cyc 412..605 CDD:306677 55/162 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.