DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43373 and gucy1a2

DIOPT Version :9

Sequence 1:NP_001097622.2 Gene:CG43373 / 39835 FlyBaseID:FBgn0263131 Length:1854 Species:Drosophila melanogaster
Sequence 2:XP_009290254.2 Gene:gucy1a2 / 100330875 ZFINID:ZDB-GENE-121023-3 Length:608 Species:Danio rerio


Alignment Length:349 Identity:88/349 - (25%)
Similarity:153/349 - (43%) Gaps:78/349 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   603 RLREALIGGILLSVVHLYTCLRLNAMQDEAVEMIHWEELLCTLVALLLANLTGVYTHWPKEKAQR 667
            ||.|.:..|:.||.:.::     :|.:|                .:|:...........|...:.
Zfish   304 RLEELMGRGLHLSDIPIH-----DATRD----------------VILVGEQAKAQDGLKKRMDKL 347

  Fly   668 KAFIE-TRQCIEARLRTQRENQQQERLLLSVLPRHVAMEMKDDIAGQPRDTQFHKIYIQRHENVS 731
            ||.:| |.|.:|      .|.::...||.|:.|..||..:..   |.|       :..::.::|:
Zfish   348 KATLEKTHQALE------EEKRRTVDLLYSIFPGDVAQRLWQ---GLP-------VQAKKFDDVT 396

  Fly   732 ILFADICGFTSLSDQCTAEELVRLLNELFARFDRLAAEHHCLRIKLLGDCYYCVSGLPEPRPDHA 796
            :||:||.|||::..|||..:::.:||||:.|||.........:|:.:||.|....||......||
Zfish   397 MLFSDIVGFTAVCAQCTPMQVISMLNELYTRFDYQCGILDVYKIETIGDAYCVAGGLHRKIDSHA 461

  Fly   797 HCAVEMGLDMIDAIALVREVMAVN---VNMRVGIHTGRVHCGVLGLVKWQFDVWSNDVTLANHME 858
            .....|.|.|::   |..||:..:   :.:|:|||:|.|..||:|::..::.::.|:||||:..|
Zfish   462 KPIALMALKMME---LSEEVLTPDGKPIKLRIGIHSGSVLAGVVGVMMPRYCLFGNNVTLASKFE 523

  Fly   859 SGGIPGRVHITKETLKCLDGDYEVEVGKGNERNSYLKDHQIETYLIVPGDIYRPHKKSRNRLQVN 923
            ||..|..::::..|.:.|..|                    .::..:|          |:|.::.
Zfish   524 SGSHPRCINVSPTTYQLLRDD--------------------RSFTFIP----------RSRQELP 558

  Fly   924 GNISKEL----RMMGHGTAQKHTS 943
            .|..||:    ..:..|.:|.|.|
Zfish   559 DNFPKEIPGICYFLEAGKSQSHAS 582

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43373NP_001097622.2 AC_N <523..720 CDD:292831 25/117 (21%)
CYCc 686..881 CDD:214485 62/197 (31%)
Guanylate_cyc 722..895 CDD:278633 53/175 (30%)
DUF1053 <949..1005 CDD:283888
CYCc 1259..1455 CDD:214485
Guanylate_cyc 1285..1479 CDD:278633
gucy1a2XP_009290254.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.