DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43373 and gucy1b1

DIOPT Version :9

Sequence 1:NP_001097622.2 Gene:CG43373 / 39835 FlyBaseID:FBgn0263131 Length:1854 Species:Drosophila melanogaster
Sequence 2:NP_001238874.1 Gene:gucy1b1 / 100150304 ZFINID:ZDB-GENE-090313-160 Length:608 Species:Danio rerio


Alignment Length:539 Identity:133/539 - (24%)
Similarity:220/539 - (40%) Gaps:162/539 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   416 EKRSLQD--AGLVK-------GGGIQTQLIVDTATDDDADVYTVASDDD------DDVDGGRSAG 465
            |:..|||  .|::|       |..|:.::|...:.:.|...:.:...|.      :|:||....|
Zfish   138 EREGLQDIVIGIIKTVAQQIHGTEIEMKVIQPKSEECDHIKFLIEEKDSEEEAFYEDLDGFEENG 202

  Fly   466 SKHITYTPRVRDYNQISHAERDEVLNTSSNAGVATDNSDPPLGYGQLIPLILMQVDESVLVFLIV 530
            ::.          .:||                       |..:.:..|..|| .|:.     ::
Zfish   203 TQE----------TRIS-----------------------PYTFCKAFPFHLM-FDKD-----LM 228

  Fly   531 MLICGIVYAFLLCILSKPAMNEIFLVLVSYV-----ILGTFLAIEVAVSYAMQPSKSFNGSACCI 590
            :..||               |.||.||....     :...|..:...:.:      ||:|     
Zfish   229 LTQCG---------------NAIFRVLPQLQPGVCNLSSVFSLVRPHIDF------SFHG----- 267

  Fly   591 VLIYMTYTMLPLRLREALIG-----------GILLSVVHLYTCLRLNAMQDEAVEMIHWEE---- 640
            :|.::. |:..||.:|.|:.           |..:|      ||||..      :||...|    
Zfish   268 ILSHIN-TVFVLRSKEGLLNVETAENEDELTGTEIS------CLRLKG------QMISLPETENI 319

  Fly   641 -LLCTLVALLLANLT--GVY-THWPKEKAQRKAFI-------ETRQCIEARLRTQR--------- 685
             .||:...:.|.:||  |:| :..|...|.|...:       |.:...|..:.|.|         
Zfish   320 LFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQHTLRALE 384

  Fly   686 -ENQQQERLLLSVLPRHVAMEMKDDIAGQPRDTQFHK--IYIQRHENVSILFADICGFTSL-SDQ 746
             |.::.:|||.||||..||.|::            ||  :..:|::||:|||:.|.||.:. |..
Zfish   385 DEKKKTDRLLYSVLPPSVANELR------------HKRPVPAKRYDNVTILFSGIVGFNAFCSKH 437

  Fly   747 CTAE---ELVRLLNELFARFDRLAAEH---HCLRIKLLGDCYYCVSGLPEPRPDHAHCAVEMGLD 805
            .:||   ::|.|||:::.|||.|....   :..:::.:||.|..|||||||...||.....:.||
Zfish   438 ASAEGAIKIVNLLNDIYTRFDILTDSRKNPYVYKVETVGDKYMTVSGLPEPCTHHAKSICHLALD 502

  Fly   806 MIDAIALVREVMAVNVNMRVGIHTGRVHCGVLGLVKWQFDVWSNDVTLANHMESGGIPGRVHITK 870
            |::....|: |....|.:.:|||||.|..||:|....::.::.|.|.|.:..|:.|..|::::::
Zfish   503 MMEIAGQVK-VDEDPVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSE 566

  Fly   871 ETLKCL------DGDYEVE 883
            .|.:||      |..:.:|
Zfish   567 YTYRCLQSVENADPQFHLE 585

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43373NP_001097622.2 AC_N <523..720 CDD:292831 51/237 (22%)
CYCc 686..881 CDD:214485 70/209 (33%)
Guanylate_cyc 722..895 CDD:278633 58/175 (33%)
DUF1053 <949..1005 CDD:283888
CYCc 1259..1455 CDD:214485
Guanylate_cyc 1285..1479 CDD:278633
gucy1b1NP_001238874.1 HNOB 2..166 CDD:285002 8/27 (30%)
HNOBA 207..406 CDD:285003 57/266 (21%)
CYCc 385..584 CDD:214485 70/211 (33%)
Guanylate_cyc 412..605 CDD:278633 58/175 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.