DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43373 and gucy1a2

DIOPT Version :9

Sequence 1:NP_001097622.2 Gene:CG43373 / 39835 FlyBaseID:FBgn0263131 Length:1854 Species:Drosophila melanogaster
Sequence 2:NP_001120379.1 Gene:gucy1a2 / 100145454 XenbaseID:XB-GENE-1011801 Length:712 Species:Xenopus tropicalis


Alignment Length:312 Identity:84/312 - (26%)
Similarity:145/312 - (46%) Gaps:64/312 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   662 KEKAQRKAFIE-TRQCIEARLRTQRENQQQERLLLSVLPRHVAMEMKDDIAGQPRDTQFHKIYIQ 725
            |...:.||.:| |.|.:|      .|.::...||.|:.|..||.::.:..:.|.|          
 Frog   447 KRMDKLKATLEKTHQALE------EEKKKTVDLLYSIFPGDVAQQLWEGKSVQAR---------- 495

  Fly   726 RHENVSILFADICGFTSLSDQCTAEELVRLLNELFARFDRLAAEHHCLRIKLLGDCYYCVSGLPE 790
            :.::|::||:||.|||::..|||..:::.:||||:.|||.........:::.:||.|...:||..
 Frog   496 KFDDVTMLFSDIVGFTAVCAQCTPMQVISMLNELYTRFDYQCGFLDIYKVETIGDAYCVAAGLLR 560

  Fly   791 PRPDHAHCAVEMGLDMIDAIALVREVMAVN---VNMRVGIHTGRVHCGVLGLVKWQFDVWSNDVT 852
            ....||.....|.|.|::   |..||:..:   :.||:|||:|.|..||:|:...::.::.|:||
 Frog   561 QSNSHAKPIALMALKMME---LSEEVLTPDGRPIKMRIGIHSGSVLAGVVGVRMPRYCLFGNNVT 622

  Fly   853 LANHMESGGIPGRVHITKETLKCLDGDYEVEVGKGNERNSYLKDHQIETYLIVPGDIYRPHKKSR 917
            ||:..|||..|.|::::..|       |::           |||.  ..:..||          |
 Frog   623 LASKFESGSHPRRINVSPTT-------YQL-----------LKDE--ANFHFVP----------R 657

  Fly   918 NRLQVNGNISKELRMMGHGTAQKHTSKFGFGDSSESAKDPEDEVNEYLMRAI 969
            :|.::..|..||:..:.:           |.::....|.|:..:....||.:
 Frog   658 SREELPDNFPKEIPGICY-----------FLEADSGQKQPKPSLTSVRMRKV 698

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43373NP_001097622.2 AC_N <523..720 CDD:292831 16/58 (28%)
CYCc 686..881 CDD:214485 61/197 (31%)
Guanylate_cyc 722..895 CDD:278633 53/175 (30%)
DUF1053 <949..1005 CDD:283888 4/21 (19%)
CYCc 1259..1455 CDD:214485
Guanylate_cyc 1285..1479 CDD:278633
gucy1a2NP_001120379.1 Pap_E4 30..>86 CDD:367150
HNOB <132..248 CDD:377902
HNOBA 296..486 CDD:369471 14/44 (32%)
Guanylate_cyc 492..679 CDD:306677 66/240 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.