DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33158 and CG2017

DIOPT Version :9

Sequence 1:NP_788515.1 Gene:CG33158 / 39834 FlyBaseID:FBgn0053158 Length:1033 Species:Drosophila melanogaster
Sequence 2:NP_649603.3 Gene:CG2017 / 40733 FlyBaseID:FBgn0037391 Length:643 Species:Drosophila melanogaster


Alignment Length:183 Identity:41/183 - (22%)
Similarity:69/183 - (37%) Gaps:37/183 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 QVRNICILAHVDHGKTTL-----ADSLVASNGIISQRMAGKLRYLDNRS----DEQERGITMKSS 73
            :|| :.:|...|.||:||     .|.|...:|.....|...:..:.:..    ..:..|.....:
  Fly   215 EVR-VAVLGGADAGKSTLLGVLTQDELDNGHGRARLNMFRHMHEIQSGRTSCISHETLGFDALGN 278

  Fly    74 SISLYYQE---AEEMAGNPDYLINLIDSPGHVDFSSEVSTAVRLCDG-----AIVVVDVVEGVGP 130
            .::..|.|   |||::.....|:..:|..||..:   :.|.|:...|     |::||....|...
  Fly   279 VVNYKYNEMMTAEEISDRSSKLVTFMDLAGHRRY---MRTTVQALSGYSPHYAMLVVSAGSGCND 340

  Fly   131 QTRACLRQIYEEQLKPVLVLNKLDR----LILEKQMDPLDAYF-HLCQVLEQV 178
            .|        ||.|   .::..||.    |:.:..:...||.. .||.:|..:
  Fly   341 TT--------EEHL---AIVRALDMPFFVLVTKTDITSPDATVQELCNLLTTI 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33158NP_788515.1 PTZ00416 15..1016 CDD:240409 41/183 (22%)
EF2 20..249 CDD:206672 40/181 (22%)
EF2_II 485..572 CDD:293913
EF2_snRNP_III 587..658 CDD:293918
aeEF2_snRNP_like_IV 658..899 CDD:238839
eEF2_snRNP_like_C 896..974 CDD:239763
CG2017NP_649603.3 GTPBP1 100..635 CDD:227583 41/183 (22%)
GTPBP1_like 217..436 CDD:206728 40/181 (22%)
GTPBP_II 450..536 CDD:293895
GTPBP_III 547..634 CDD:294007
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464637
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.