DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33158 and mEFTu2

DIOPT Version :9

Sequence 1:NP_788515.1 Gene:CG33158 / 39834 FlyBaseID:FBgn0053158 Length:1033 Species:Drosophila melanogaster
Sequence 2:NP_610288.1 Gene:mEFTu2 / 35681 FlyBaseID:FBgn0033184 Length:456 Species:Drosophila melanogaster


Alignment Length:427 Identity:95/427 - (22%)
Similarity:163/427 - (38%) Gaps:120/427 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NICILAHVDHGKTTLADSLVASNGIISQR-MAGKLRY--LDNRSDEQERGITMKSSSISLYYQEA 82
            |:..:.|||||||||.   .|...|.||: :|..|.|  :|...:|:.||||:.:..|.  |...
  Fly    59 NVGTIGHVDHGKTTLT---AAITRIQSQKGLAEYLSYDQIDRAPEEKARGITINACHIG--YSTT 118

  Fly    83 EEMAGNPDYLINLIDSPGHVDFSSEVSTAVRLCDGAIVVVDVVEGVGPQTRACLRQIYEEQLKPV 147
            |....:       .|.|||.|:...:.:.....||||:||...:|..||||..|....:..::.:
  Fly   119 ERTYAH-------TDCPGHADYIKNMISGASQMDGAILVVAATDGQMPQTREHLLLAKQVGIQRI 176

  Fly   148 LV-LNKLDRL------ILEKQMDPLDAYFHLCQVLEQVNAVLGSIFASDILA-KEDITK--KDNY 202
            :| :||.|.:      ::|.:|..:.:.|.    .:.||:.:  |..|.:|| :||.::  ..:.
  Fly   177 IVFINKADLVDQEVLELVEIEMREMLSDFG----FDGVNSPV--ICGSALLALREDKSEFGVPSI 235

  Fly   203 ESALEEVDD-----------------SELYFSPSSGNVIFCSAYDG----------------WAF 234
            |..||:.|.                 ...:..|..|.|:..:...|                ...
  Fly   236 EKLLEQCDSYIPTPQRDISSPFILPIDNAFTVPGRGTVVVGTIKRGTIPRNADADLLGFNQNLKT 300

  Fly   235 SVRDFAAMYAKRLEMSR----------------------------KDLENVLWGDFYYNSKKKEA 271
            |:.|. .::.|.:..::                            :|:.|...|..|..|:.:  
  Fly   301 SISDI-QIFRKSVPQAQAGENVGALLRGIKISAVERGMLLCATGSEDISNHFEGSMYLLSRAE-- 362

  Fly   272 LPGAQEKAKKPMFVQFVLENIWSL---YDIIAIRKDKDKLPGIAEKLGLKLATRDLRLTDPKLQI 333
              |.:.|.....::|.:....|::   .||:.  .:...:||...::.:.| .|.:.:|.     
  Fly   363 --GGRVKPMLSKYIQQLFSQTWNVPARIDIVP--SEAMLMPGEHGQVRVTL-LRKMVMTP----- 417

  Fly   334 KAVLGQWLPIDKS----VLHMVIQHVP----PPHKIS 362
                ||...|.::    ...||.|.:|    |.:|:|
  Fly   418 ----GQAFTIRENGATVATGMVTQRLPSLDLPKNKLS 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33158NP_788515.1 PTZ00416 15..1016 CDD:240409 95/427 (22%)
EF2 20..249 CDD:206672 69/273 (25%)
EF2_II 485..572 CDD:293913
EF2_snRNP_III 587..658 CDD:293918
aeEF2_snRNP_like_IV 658..899 CDD:238839
eEF2_snRNP_like_C 896..974 CDD:239763
mEFTu2NP_610288.1 PRK00049 53..437 CDD:234596 90/412 (22%)
EF_Tu 56..249 CDD:206671 62/207 (30%)
EFTU_II 257..343 CDD:293898 7/86 (8%)
mtEFTU_III 347..437 CDD:294005 20/105 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464592
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.