DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33158 and eRF3

DIOPT Version :9

Sequence 1:NP_788515.1 Gene:CG33158 / 39834 FlyBaseID:FBgn0053158 Length:1033 Species:Drosophila melanogaster
Sequence 2:NP_001260415.1 Gene:eRF3 / 34658 FlyBaseID:FBgn0020443 Length:619 Species:Drosophila melanogaster


Alignment Length:368 Identity:73/368 - (19%)
Similarity:133/368 - (36%) Gaps:103/368 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PVVEGSDLVLLQ--RRRQQVRNICILAHVDHGKTTLADSLVASNGIISQRMAGKLR--------- 55
            |.|....:|.::  |.:::..|:..:.|||.||:|:...:::..|::.:|...|..         
  Fly   176 PKVSKKKVVKVEENRSKREHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSRE 240

  Fly    56 ------YLDNRSDEQERGITMKSSSISLYYQEAEEMAGNPDYLINLIDSPGHVDFSSEVSTAVRL 114
                  .||...:|:::|   |:..:...:.|.:...      ..::|:|||..|...:......
  Fly   241 SWYLSWALDTNQEERDKG---KTVEVGRAFFETDRKH------FTILDAPGHKSFVPNMIGGAAQ 296

  Fly   115 CDGAIVVVDVVEGV-------GPQTRACLRQIYEEQLKPVLVL-NKLDRLILEKQMDPL----DA 167
            .|.|::|:...:|.       |.|||..........:|.::|| ||:|        ||.    ..
  Fly   297 ADLAVLVISARKGEFETGFDRGGQTREHAMLAKTAGVKHLVVLVNKMD--------DPTVNWDQT 353

  Fly   168 YFHLCQVLEQVNAVLGSIFASDILAKEDI---TKKDNYESALEEVDDSELYFSPSSG-------- 221
            .::.|                    |:.|   .||..:..|      .:|.|.|.||        
  Fly   354 RYNEC--------------------KDKILPYLKKLGFNPA------KDLTFMPCSGLSGYGLKD 392

  Fly   222 --NVIFCSAYDGWAF--SVRDFAAMYAKR-------LEMSRKDLENVLWGDFYYNSKKKEALPGA 275
              ....|..|.|.||  .:.:..::..|.       :....||:..|:.|.....:.:|     .
  Fly   393 QIPETLCPWYRGPAFIPFIDELPSLNRKSDGPFIMPIVDKYKDMGTVVMGKVESGTARK-----G 452

  Fly   276 QEKAKKPMFVQFVLENIWS-LYDIIAI---RKDKDKLPGIAEK 314
            |.....|...|..::.::| .:::.::   ...|.||.||.|:
  Fly   453 QNLLVMPNRTQVAVDQLFSDDFEVTSVGPGENVKIKLKGIEEE 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33158NP_788515.1 PTZ00416 15..1016 CDD:240409 69/353 (20%)
EF2 20..249 CDD:206672 54/277 (19%)
EF2_II 485..572 CDD:293913
EF2_snRNP_III 587..658 CDD:293918
aeEF2_snRNP_like_IV 658..899 CDD:238839
eEF2_snRNP_like_C 896..974 CDD:239763
eRF3NP_001260415.1 PAM2 12..28 CDD:284542
TEF1 191..619 CDD:227581 69/353 (20%)
EF1_alpha 197..416 CDD:206670 53/261 (20%)
eRF3_II 424..505 CDD:293906 15/77 (19%)
eRF3_C_III 511..617 CDD:294003
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464655
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.