DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33158 and F58G1.8

DIOPT Version :9

Sequence 1:NP_788515.1 Gene:CG33158 / 39834 FlyBaseID:FBgn0053158 Length:1033 Species:Drosophila melanogaster
Sequence 2:NP_496753.1 Gene:F58G1.8 / 186541 WormBaseID:WBGene00010270 Length:83 Species:Caenorhabditis elegans


Alignment Length:89 Identity:15/89 - (16%)
Similarity:32/89 - (35%) Gaps:16/89 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   534 LYMFMGGELQLLDEVPAGNIVGIGGLESHIVKTATLSSSLDCTSFSELSVMATPILRVAIEPVQP 598
            |.:.:...:||||                :....|.|:..:.....|...:..|.:.||::.|..
 Worm     7 LLLMLEISVQLLD----------------LTARETFSTDQNLAPHCEPIHIPEPAISVALKSVNR 55

  Fly   599 QDMPKLVKGLKLLNQADACVQVSV 622
            :|....:|.|....:.:...::.:
 Worm    56 KDADNFIKALTRFTKEEPTFRIKL 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33158NP_788515.1 PTZ00416 15..1016 CDD:240409 15/89 (17%)
EF2 20..249 CDD:206672
EF2_II 485..572 CDD:293913 7/37 (19%)
EF2_snRNP_III 587..658 CDD:293918 7/36 (19%)
aeEF2_snRNP_like_IV 658..899 CDD:238839
eEF2_snRNP_like_C 896..974 CDD:239763
F58G1.8NP_496753.1 FusA <17..>79 CDD:357662 13/77 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0480
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.