DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33158 and LOC110438493

DIOPT Version :9

Sequence 1:NP_788515.1 Gene:CG33158 / 39834 FlyBaseID:FBgn0053158 Length:1033 Species:Drosophila melanogaster
Sequence 2:XP_021326691.1 Gene:LOC110438493 / 110438493 -ID:- Length:298 Species:Danio rerio


Alignment Length:279 Identity:161/279 - (57%)
Similarity:204/279 - (73%) Gaps:24/279 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LVLLQRRRQQVRNICILAHVDHGKTTLADSLVASNGIISQRMAGKLRYLDNRSDEQERGITMKSS 73
            ::.||::...:||:|||||||||||||||.|||||||||.|:||||||||:|.|||.||||||||
Zfish    27 IIALQKKTAHIRNLCILAHVDHGKTTLADCLVASNGIISSRLAGKLRYLDSREDEQIRGITMKSS 91

  Fly    74 SISLYYQEAEEMAGNPDYLINLIDSPGHVDFSSEVSTAVRLCDGAIVVVDVVEGVGPQTRACLRQ 138
            :|||::     ..|..::||||||||||||||||||||||||||||||||.||||.|||:..|||
Zfish    92 AISLHF-----ATGGVEFLINLIDSPGHVDFSSEVSTAVRLCDGAIVVVDAVEGVCPQTQVVLRQ 151

  Fly   139 IYEEQLKPVLVLNKLDRLILEKQMDPLDAYFHLCQVLEQVNAVLGSIFASDILAKEDITKKD--- 200
            .:.|.::||||:||:||||:|.::...:||.||.::|||||||.|::|.|.:|  |:..:||   
Zfish   152 AWLENIRPVLVINKIDRLIVELKLTSQEAYVHLQKILEQVNAVTGTLFTSKVL--EERAEKDAGS 214

  Fly   201 --------------NYESALEEVDDSELYFSPSSGNVIFCSAYDGWAFSVRDFAAMYAKRLEMSR 251
                          ::.:.|||.|||:|||||..|||:|.||.|||.||:..||.||::::.:..
Zfish   215 QSSFTENESGDHVYDWSAGLEETDDSDLYFSPDRGNVVFASAIDGWGFSIHQFAEMYSQKMGIRS 279

  Fly   252 KDLENVLWGDFYYNSKKKE 270
            ..|...||||||.|:|.|:
Zfish   280 SVLLKTLWGDFYLNAKAKK 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33158NP_788515.1 PTZ00416 15..1016 CDD:240409 159/273 (58%)
EF2 20..249 CDD:206672 149/245 (61%)
EF2_II 485..572 CDD:293913
EF2_snRNP_III 587..658 CDD:293918
aeEF2_snRNP_like_IV 658..899 CDD:238839
eEF2_snRNP_like_C 896..974 CDD:239763
LOC110438493XP_021326691.1 EF2 38..272 CDD:206672 148/240 (62%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140796at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.