DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TyrRS and MSY1

DIOPT Version :9

Sequence 1:NP_648895.1 Gene:TyrRS / 39829 FlyBaseID:FBgn0027080 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_015228.1 Gene:MSY1 / 856007 SGDID:S000006018 Length:492 Species:Saccharomyces cerevisiae


Alignment Length:452 Identity:83/452 - (18%)
Similarity:150/452 - (33%) Gaps:139/452 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 TKILAERDLKIYWGTATTGKP-HVAYFVPMSKIADFLKAGCEVTILFADLHAYL---DNMKAPWS 87
            ||:.....:|:|.|...|.:. |:...||:..:..|...|.::..:.......:   ...|....
Yeast    78 TKLNGNDKIKLYCGVDPTAQSLHLGNLVPLMVLLHFYVKGHDIVTVIGGATGKVGDPSGRKTERD 142

  Fly    88 LLELRTKYYEQVIKAMLSSIGVPLEKLKFVKGSDYQLSK----------EYT------------- 129
            ::|      ..:.::.::||...|::. |..|.:|..::          :||             
Yeast   143 VME------NDIRQSNVASISQQLQRF-FKNGLEYYRNRCALTEDVPSGKYTPRNNFNWWKDIKM 200

  Fly   130 LDV-------YKLSSVVTQHDAKKAGAEVVKQVEYPLLSGLLYPGLQALDEEYL----KVDAQFG 183
            ||.       .::.|::.: |:..:..:....:.:   :...|..|||.|..:|    .|..|.|
Yeast   201 LDFLADFGRHIRVQSMLAR-DSISSRLQTKNGLGF---NEFTYQVLQAYDFYHLYKEENVTIQVG 261

  Fly   184 GVDQ-----------RKIFTFSEKYLPQLGYEKRIHFMNPMVPGLAGGKMSSSEEDS-------- 229
            |.||           .:|.....|.||       .....|::....|.|...|..::        
Yeast   262 GNDQWGNITAGIDLINRIQPIKNKGLP-------FGITVPLLTTATGEKFGKSAGNAVFIDPSIN 319

  Fly   230 ---------------------KIDLLDSPANVKKKLKKAFCEPGNIADNGLLSFVKHVLFSLFKE 273
                                 ||....:.:.:||.::.....|.......||:  |.|...|:..
Yeast   320 TAYDVYQFFYNTLDADVPKFLKIFTFLNSSEIKKIVETHIKSPSLRYGQTLLA--KEVTDMLYGV 382

  Fly   274 GEGFEVNREA-------EHGGDVTFLKYEDLEKYYAEDKLHPGDLKATVEKYINRLLDPIR---- 327
            |.|.:  .||       .:.|.::..|..||.|            ||.:.:|.:|.:|.|:    
Yeast   383 GSGSD--SEALSNIIFGRYDGTLSAAKLVDLCK------------KARILQYADREIDLIKLICK 433

  Fly   328 --KAFENPELQKLS-AAAYPPPAKVKAGAAPAAGADEDAPHRLD-----IRVGK----VVEV 377
              ....:...:||| .:.|...:|.|..    ......||..:|     :|:||    ::|:
Yeast   434 LVNCSVSEARRKLSQGSVYLHHSKSKVN----ENISNLAPFL
IDDRVLILRIGKQKCFIIEM 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TyrRSNP_648895.1 nt_trans 8..334 CDD:294020 70/397 (18%)
tyrS 12..332 CDD:272976 70/395 (18%)
tRNA_bind_EMAP-II_like 364..466 CDD:239198 6/23 (26%)
MSY1NP_015228.1 tyrS 54..471 CDD:272976 78/430 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0162
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.