DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TyrRS and AT5G02680

DIOPT Version :10

Sequence 1:NP_648895.1 Gene:TyrRS / 39829 FlyBaseID:FBgn0027080 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001318459.1 Gene:AT5G02680 / 831842 AraportID:AT5G02680 Length:133 Species:Arabidopsis thaliana


Alignment Length:45 Identity:12/45 - (26%)
Similarity:20/45 - (44%) Gaps:16/45 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   374 VVEVARHPDADTLYVLKIDLAEAQPRTIISGLVKFVTEEELNQRL 418
            :::..:||.|:.|||.:||:...                |:|.||
plant    92 IMQAEKHPKANALYVEEIDIGGG----------------EINYRL 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TyrRSNP_648895.1 nt_trans 8..334 CDD:469580
PLN02610 <366..525 CDD:215329 12/45 (27%)
AT5G02680NP_001318459.1 PLN02610 <54..>108 CDD:215329 6/15 (40%)
tRNA_bindingDomain 92..>126 CDD:444833 12/45 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.