DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TyrRS and AT3G59980

DIOPT Version :9

Sequence 1:NP_648895.1 Gene:TyrRS / 39829 FlyBaseID:FBgn0027080 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_191557.1 Gene:AT3G59980 / 825168 AraportID:AT3G59980 Length:273 Species:Arabidopsis thaliana


Alignment Length:215 Identity:79/215 - (36%)
Similarity:116/215 - (53%) Gaps:28/215 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 QKLSAAAYPPPAKVKAGAAPAAG----ADE---------------DAPHRLDIRVGKVVEVARHP 381
            |:.:.:::|..|.. ..|||.||    |||               :..:.|||:||::|:..:|.
plant    60 QQRNRSSWPRVATF-CTAAPDAGTTVSADESEKKSESQKEEENVKETANLLDIKVGRIVKAWQHE 123

  Fly   382 DADTLYVLKIDLAEAQPRTIISGLVKFVTEEELNQRLVAVLCNLKPSKMRGILSEGMVLCTSNAD 446
            :||:|||.::|:.||:||.|.|||||:|..:.|....|.||.||||..|||:.|.||:|..|:|.
plant   124 EADSLYVEEVDIGEAEPRIICSGLVKYVPLDLLQGASVVVLANLKPRNMRGVKSCGMLLAASDAA 188

  Fly   447 HTVVEPIVLPATATAGSRLSF---EGFSGTPDEQLNP----KKKVWEKLSADFKTNSDGLAVWKD 504
            |..||.:|.|..:..|.|:.|   |.....| |...|    |||:||.:....||::.|:::.|:
plant   189 HENVELLVPPEGSVPGDRVWFGNEEDLEQLP-EPAPPNKVQKKKMWELVQPLLKTDASGVSMLKE 252

  Fly   505 NFLLTPEGEKLSSKLANCSI 524
            :.:.|..|...|..|.|.:|
plant   253 HLMRTSSGLVTSKSLRNANI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TyrRSNP_648895.1 nt_trans 8..334 CDD:294020
tyrS 12..332 CDD:272976
tRNA_bind_EMAP-II_like 364..466 CDD:239198 48/101 (48%)
AT3G59980NP_191557.1 tRNA_bind_EMAP-II_like 104..208 CDD:239198 48/103 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000771
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11586
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.